close

SimulationCraft 603-19

for World of Warcraft 6.0.3 Live (build level 19243)

Table of Contents

Raid Summary

 

DPS Chart
Ciaran

Ciaran : 20226 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
20225.7 20225.7 8.8 / 0.044% 2789.3 / 13.8% 36.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
553.3 553.3 Mana 0.26% 36.3 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Ciaran/advanced
Talents
  • 15: Feline Swiftness
  • 30: Ysera's Gift
  • 45: Typhoon
  • 60: Force of Nature
  • 75: Incapacitating Roar
  • 90: Nature's Vigil
  • 100: Balance of Power
  • Talent Calculator
Glyphs
  • Glyph of Guided Stars
  • Glyph of Rebirth
  • Glyph of Stars
  • Glyph of the Chameleon
  • Glyph of the Stag
Professions
  • leatherworking: 14
  • skinning: 289

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Ciaran+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x120&chd=t:30328|15396|11486&chds=0,60657&chco=8AD0B1,69CCF0,ABD473&chm=t++30328++starsurge,8AD0B1,0,0,15|t++15396++starfire,69CCF0,1,0,15|t++11486++wrath,ABD473,2,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ciaran+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:34,20,20,13,12,2,1&chds=0,100&chdls=ffffff&chco=69CCF0,ABD473,8AD0B1,69CCF0,ABD473,C79C6E,ABD473&chl=starfire|wrath|starsurge|moonfire|sunfire|shattered_bleed|treant: wrath&
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Ciaran+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:abgimrty036468567512yzvvrnnihgfffeeddcbbaaaYZaabbaZZaZZZaabbbcbccbaaabcaabbaZYYYXYYYYYZaaZYZaZZabbbbcbbbbbaZZabbabbaZZZZZZZZZabccbbbcabccdcddcdddcbaabcbbcbbaaaZZZZZYZabbaZaaZaacddefggijkklnoppppppoommljigggfddccbaaaZZZZYZaaaaZabaaaababbbbbcbaZaaaaaaaaZaaZZZZZZabbcbbccbbcccccccccccbaabaaZaaZZZZZZZZZYZabbaabbbabbbbbcbbbcbaZZaaZZZZZZZZYYYZYYZaaaaaabaaabaaaaaaaaaZXWVTSQPNMK&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.503048,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=20226|max=40206&chxp=1,1,50,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Ciaran+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,2,2,6,13,18,25,61,111,158,245,368,466,627,846,1030,1224,1322,1482,1611,1689,1770,1596,1519,1393,1289,1185,1009,862,721,616,424,338,269,206,163,97,81,47,36,26,18,10,8,4,2,1,1,2&chds=0,1770&chbh=5&chxt=x&chxl=0:|min=17492|avg=20226|max=23448&chxp=0,1,46,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ciaran+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:43.9,35.6,13.0,3.6,3.4,0.3&chds=0,100&chdls=ffffff&chco=69CCF0,ABD473,8AD0B1,ABD473,69CCF0,ffffff&chl=starfire 132.0s|wrath 107.2s|starsurge 39.1s|sunfire 10.8s|moonfire 10.3s|waiting 0.8s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Ciaran 20226
moonfire 2527 12.5% 9.0 34.97sec 84235 73496 Direct 9.0 4799 9090 5343 12.7% 1.8 1616 3141 12.3%  
Periodic 175.7 3324 6752 3766 12.9% 40.3 1002 2033 12.9% 99.0%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.01 9.01 175.67 175.67 1.1462 1.6953 758767.76 758767.76 0.00 2462.36 73495.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.23 12.33% 3141.32 2058 7708 640.91 0 7708 712 712 0.00
multistrike 1.61 87.67% 1615.61 1029 3854 1311.10 0 3854 2604 2604 0.00
hit 7.87 87.32% 4799.44 0 12846 4760.32 2379 8441 37750 37750 0.00
crit 1.14 12.68% 9089.93 0 25692 6314.86 0 25692 10383 10383 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.2 12.93% 2032.95 1193 6123 2022.17 0 6123 10586 10586 0.00
multistrike 35.1 87.07% 1001.91 596 3062 1003.97 759 1392 35125 35125 0.00
hit 153.0 87.10% 3324.12 30 10206 3330.56 3067 3632 508653 508653 0.00
crit 22.7 12.90% 6751.85 71 20411 6768.65 4739 10247 152956 152956 0.00
 
DPS Timeline Chart
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that burns the enemy for {$164812s1=1 + 40.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.292500
  • base_td:0.00
  • dot_duration:40.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
shattered_bleed 384 1.9% 17.4 17.67sec 6634 0 Direct 17.4 1616 3249 1826 12.8% 4.0 485 974 13.1%  
Periodic 97.3 783 0 783 0.0% 22.3 238 0 0.0% 32.3%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 97.26 97.26 0.0000 1.0000 115467.67 115467.67 0.00 1187.26 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.52 13.06% 974.17 952 1142 393.24 0 1142 508 508 0.00
multistrike 3.47 86.94% 485.01 476 571 467.22 0 571 1682 1682 0.00
hit 15.17 87.19% 1616.48 1586 1904 1616.63 1586 1745 24529 24529 0.00
crit 2.23 12.81% 3248.63 3173 3807 2915.18 0 3807 7245 7245 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 22.3 100.00% 237.96 238 238 237.96 238 238 5312 5312 0.00
hit 97.3 100.00% 783.41 1 793 783.68 756 793 76192 76192 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
starfire 6786 33.5% 52.7 5.61sec 38589 15396 Direct 52.7 31718 65069 36106 13.2% 12.1 9527 19510 13.1%  

Stats details: starfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.66 52.66 0.00 0.00 2.5064 0.0000 2032121.15 2032121.15 0.00 15396.26 15396.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.58 13.10% 19509.73 10830 28949 15588.98 0 28949 30848 30848 0.00
multistrike 10.49 86.90% 9527.14 5264 14474 9546.18 6473 14474 99922 99922 0.00
hit 45.73 86.84% 31717.62 17546 48248 31784.73 28125 35839 1450524 1450524 0.00
crit 6.93 13.16% 65068.60 36100 96495 65210.47 0 96495 450827 450827 0.00
 
DPS Timeline Chart
 

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)
Spelldata
  • id:2912
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that causes {$s1=1 + 187.2%} Arcane damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.340000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
starsurge 3951 19.5% 30.7 10.00sec 38648 30328 Direct 30.5 31955 65368 36324 13.1% 7.0 9586 19579 13.2%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.68 30.54 0.00 0.00 1.2743 0.0000 1185775.74 1185775.74 0.00 30328.30 30328.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.92 13.16% 19579.45 14864 27833 11679.33 0 27833 18077 18077 0.00
multistrike 6.10 86.84% 9585.74 7432 13917 9571.50 0 13917 58426 58426 0.00
hit 26.54 86.92% 31954.53 24773 46389 32000.73 29073 36373 848232 848232 0.00
crit 3.99 13.08% 65368.19 49548 92778 64400.86 0 92778 261040 261040 0.00
 
DPS Timeline Chart
 

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_empowerment.down&eclipse_energy>20
Spelldata
  • id:78674
  • name:Starsurge
  • school:spellstorm
  • tooltip:
  • description:Instantly causes {$78674s1=2242} Spellstorm damage to the target, benefiting from your strongest current Eclipse bonus. Also grants Lunar or Solar Empowerment, based on current Balance Energy side, which increases the damage of your next $164547n Starfires or $164545n Wraths by {$164545s1=30}%. Max 3 charges. Charges shared with Starfall.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.925000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
sunfire 2350 11.6% 9.5 32.33sec 74032 65373 Direct 9.5 7024 14245 7932 12.6% 2.0 2344 4670 12.8%  
Periodic 169.2 3049 6225 3458 12.9% 38.8 916 1871 12.9% 96.1%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.54 9.54 169.17 169.17 1.1325 1.7096 706291.32 706291.32 0.00 2354.19 65373.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.25 12.79% 4670.37 2058 5229 1047.58 0 5229 1178 1178 0.00
multistrike 1.72 87.21% 2344.07 1029 2615 1947.53 0 2615 4034 4034 0.00
hit 8.34 87.43% 7023.77 0 8716 7005.21 4643 8716 58583 58583 0.00
crit 1.20 12.57% 14245.22 0 17431 10239.86 0 17431 17090 17090 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.0 12.87% 1871.32 1193 4155 1859.99 0 4155 9349 9349 0.00
multistrike 33.8 87.13% 916.17 596 2077 917.40 741 1187 30988 30988 0.00
hit 147.4 87.12% 3049.45 507 6924 3053.46 2851 3328 449421 449421 0.00
crit 21.8 12.88% 6224.75 1640 13848 6234.26 4683 8950 135648 135648 0.00
 
DPS Timeline Chart
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1056.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<7|buff.solar_peak.up
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every {$t2=0} seconds.
  • description:A Solar spell that burns the enemy for {$164815s1=389} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.292500
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
wrath 4079 20.3% 61.6 4.27sec 20000 11486 Direct 61.2 16748 33554 18807 12.3% 14.0 5024 10055 12.3%  

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.55 61.25 0.00 0.00 1.7413 0.0000 1231016.28 1231016.28 0.00 11485.93 11485.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.72 12.26% 10054.70 6854 12275 8176.77 0 12275 17293 17293 0.00
multistrike 12.31 87.74% 5024.48 3427 6909 5026.75 3903 6137 61864 61864 0.00
hit 53.74 87.75% 16747.82 11424 23129 16754.91 15049 18657 900060 900060 0.00
crit 7.50 12.25% 33553.97 22847 40916 33532.99 0 40916 251798 251798 0.00
 
DPS Timeline Chart
 

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1120.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
Spelldata
  • id:5176
  • name:Wrath
  • school:nature
  • tooltip:
  • description:A Solar spell that causes {$s1=1121} Nature damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.462500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - treant 207 / 148
wrath 207 0.7% 102.3 3.13sec 435 204 Direct 101.8 362 728 409 12.9% 23.3 109 218 12.9%  

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.27 101.82 0.00 0.00 2.1313 0.0000 44514.03 44514.03 0.00 204.23 204.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.01 12.91% 218.34 211 259 207.31 0 259 658 658 0.00
multistrike 20.32 87.09% 108.60 105 129 108.64 105 119 2207 2207 0.00
hit 88.72 87.13% 361.99 351 431 362.13 356 371 32117 32117 0.00
crit 13.10 12.87% 727.69 702 862 728.06 702 862 9533 9533 0.00
 
DPS Timeline Chart
 

Action details: wrath

Static Values
  • id:113769
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113769
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Causes {$s1=180} Nature damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.187500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Ciaran
celestial_alignment 2.0 181.75sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.74 86.63% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.27 13.37% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: celestial_alignment

Static Values
  • id:112071
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:eclipse_energy>40
Spelldata
  • id:112071
  • name:Celestial Alignment
  • school:physical
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
 
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
force_of_nature 16.8 19.73sec

Stats details: force_of_nature

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.77 16.77 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.67 87.46% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.10 12.54% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: force_of_nature

Static Values
  • id:33831
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:trinket.stat.intellect.up|charges=3|target.time_to_die<21
Spelldata
  • id:33831
  • name:Force of Nature
  • school:nature
  • tooltip:
  • description:Summons a Treant which will immediately root your current target for {$113770d=30 seconds}. The Treant will cast Wrath at that target for {$113769s1=180} Nature damage every 2 sec. Lasts {$d=15 seconds}. Maximum 3 charges.
 
moonkin_form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.90 89.52% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.10 10.48% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2976.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 25.01% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
celestial_alignment 2.0 0.0 181.8sec 181.8sec 10.15% 18.64% 300.2(300.2)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • celestial_alignment_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:112071
  • name:Celestial Alignment
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
draenic_intellect_potion 2.0 0.0 186.3sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lunar_empowerment 18.2 1.1 16.6sec 16.1sec 65.41% 68.89% 1.1(1.3)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_lunar_empowerment
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lunar_empowerment_1:25.43%
  • lunar_empowerment_2:39.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Starfire is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Starfires within {$d=30 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
lunar_peak 7.1 0.0 42.5sec 42.5sec 9.86% 11.43% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_lunar_peak
  • max_stacks:2
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • lunar_peak_1:9.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171743
  • name:Lunar Peak
  • tooltip:Increases the damage of your next Moonfire by {$s1=100}%.
  • description:{$@spelldesc8921=A Lunar spell that burns the enemy for {$164812s1=1 + 40.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
nightmare_fire 2.8 0.0 125.8sec 125.8sec 18.06% 18.07% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_nightmare_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • nightmare_fire_1:18.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162919
  • name:Nightmare Fire
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
solar_empowerment 10.8 0.6 24.2sec 22.9sec 40.43% 45.01% 0.6(1.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • solar_empowerment_1:11.70%
  • solar_empowerment_2:13.10%
  • solar_empowerment_3:15.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Wraths within {$d=30 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
solar_peak 6.6 0.0 42.7sec 42.7sec 1.28% 5.57% 0.0(0.0)

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_solar_peak
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • solar_peak_1:1.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171744
  • name:Solar Peak
  • tooltip:Increases the damage of your next Sunfire by {$s1=100}%.
  • description:{$@spelldesc93402=A Solar spell that burns the enemy for {$164815s1=389} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
moonkin_form

Buff details

  • buff initial source:Ciaran
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ciaran
moonfire Mana 8.0 8455.9 1056.0 938.7 89.7
starfire Mana 52.7 50554.5 960.0 960.0 40.2
starsurge Mana 30.7 29454.0 960.0 960.0 40.3
sunfire Mana 8.6 9080.1 1056.0 951.8 77.8
wrath Mana 61.6 68937.3 1120.0 1120.0 17.9
Resource Gains Type Count Total Average Overflow
yseras_gift Health 4.12 0.00 (0.00%) 0.00 39523.87 100.00%
energy_regen Energy 168.99 0.00 (0.00%) 0.00 3533.50 100.00%
external_healing Health 4.03 0.00 (0.00%) 0.00 36644.64 100.00%
mp5_regen Mana 168.99 166271.17 (100.00%) 983.94 539643.71 76.45%
leech Health 762.89 0.00 (0.00%) 0.00 39903.99 100.00%
Resource RPS-Gain RPS-Loss
Mana 552.58 553.28
Combat End Resource Mean Min Max
Mana 159783.76 158880.00 160000.00
Eclipse 7.51 -105.00 105.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 79.5%
treant-Mana Cap 79.5%
treant-Mana Cap 79.5%
treant-Mana Cap 79.5%
treant-Mana Cap 79.5%

Procs

Count Interval
Shooting Stars overflow (buff already up) 0.1 58.4sec
Shooting Stars 19.5 14.7sec
wrong_eclipse_wrath 0.0 0.0sec
wrong_eclipse_starfire 0.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Ciaran Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Ciaran Damage Per Second
Count 25000
Mean 20225.74
Minimum 17491.55
Maximum 23447.66
Spread ( max - min ) 5956.11
Range [ ( max - min ) / 2 * 100% ] 14.72%
Standard Deviation 711.8338
5th Percentile 19107.94
95th Percentile 21443.54
( 95th Percentile - 5th Percentile ) 2335.59
Mean Distribution
Standard Deviation 4.5020
95.00% Confidence Intervall ( 20216.92 - 20234.56 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4758
0.1 Scale Factor Error with Delta=300 4325
0.05 Scale Factor Error with Delta=300 17302
0.01 Scale Factor Error with Delta=300 432554
Distribution Chart
DPS(e)
Sample Data Ciaran Damage Per Second (Effective)
Count 25000
Mean 20225.74
Minimum 17491.55
Maximum 23447.66
Spread ( max - min ) 5956.11
Range [ ( max - min ) / 2 * 100% ] 14.72%
Damage
Sample Data Ciaran Damage
Count 25000
Mean 6029439.93
Minimum 4304483.58
Maximum 7902003.33
Spread ( max - min ) 3597519.75
Range [ ( max - min ) / 2 * 100% ] 29.83%
DTPS
Sample Data Ciaran Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ciaran Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Ciaran Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ciaran Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ciaran Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ciaran Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data CiaranTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Ciaran Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=sleeper_surprise
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 moonkin_form
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=draenic_intellect
6 0.00 stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=draenic_intellect,if=buff.celestial_alignment.up
8 0.00 blood_fury,if=buff.celestial_alignment.up
9 0.00 berserking,if=buff.celestial_alignment.up
A 0.00 arcane_torrent,if=buff.celestial_alignment.up
B 16.77 force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
C 0.00 call_action_list,name=single_target,if=active_enemies=1
D 0.00 call_action_list,name=aoe,if=active_enemies>1
actions.single_target
# count action,conditions
E 17.13 starsurge,if=buff.lunar_empowerment.down&eclipse_energy>20
F 10.51 starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
G 3.04 starsurge,if=(charges=2&recharge_time<6)|charges=3
H 2.01 celestial_alignment,if=eclipse_energy>40
I 0.00 incarnation,if=eclipse_energy>0
J 8.60 sunfire,if=remains<7|buff.solar_peak.up
K 0.00 stellar_flare,if=remains<7
L 8.01 moonfire,if=buff.lunar_peak.up&remains<eclipse_change+20|remains<4|(buff.celestial_alignment.up&buff.celestial_alignment.remains<=2&remains<eclipse_change+20)
M 61.92 wrath,if=(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
N 53.08 starfire,if=(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)

Sample Sequence

0135BGLNHJNEGNNENNENBNENNNNMJMMFMMBMFJMMMMNELNNBNNENMMMMFMJBMMFMMNELNNEBNNEMMMFMMJMBFMMMMNLNENNBENNMMMMMJFMMBMMNLNNNH7NLNBNNENNENMMMBFMMJMMMFMMNEBNLNENNNMMFBMMJMFMMMMBBNNBELNNENNM

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre food Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre moonkin_form Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:00.000 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:00.000 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
0:01.328 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 21.7/105: 21% eclipse bloodlust, lunar_empowerment(2), draenic_intellect_potion
0:02.350 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 37.9/105: 36% eclipse bloodlust, lunar_empowerment(2), draenic_intellect_potion
0:04.391 celestial_alignment Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, lunar_empowerment, draenic_intellect_potion
0:04.391 sunfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, draenic_intellect_potion
0:05.413 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, draenic_intellect_potion
0:07.452 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, nightmare_fire, draenic_intellect_potion
0:08.473 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), nightmare_fire, draenic_intellect_potion
0:09.496 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), nightmare_fire, draenic_intellect_potion
0:11.536 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, nightmare_fire, draenic_intellect_potion
0:13.576 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, nightmare_fire, draenic_intellect_potion
0:14.597 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment(2), nightmare_fire, draenic_intellect_potion
0:16.639 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, lunar_empowerment, nightmare_fire, draenic_intellect_potion
0:18.681 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 66.8/105: 64% eclipse bloodlust, celestial_alignment, nightmare_fire, draenic_intellect_potion
0:19.703 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 70.7/105: 67% eclipse bloodlust, lunar_empowerment(2), nightmare_fire, draenic_intellect_potion
0:21.742 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 91.5/105: 87% eclipse bloodlust, lunar_empowerment, nightmare_fire
0:21.742 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 91.5/105: 87% eclipse bloodlust, lunar_empowerment, nightmare_fire
0:23.781 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 103.1/105: 98% eclipse bloodlust, lunar_peak, nightmare_fire
0:24.805 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse bloodlust, lunar_empowerment(2), lunar_peak, nightmare_fire
0:26.845 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 100.6/105: 96% eclipse bloodlust, lunar_empowerment, lunar_peak, nightmare_fire
0:28.884 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 86.1/105: 82% eclipse bloodlust
0:30.925 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 62.7/105: 60% eclipse bloodlust
0:32.966 Waiting 0.700 sec 160000.0/160000: 100% mana | 33.0/105: 31% eclipse bloodlust
0:33.666 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 21.8/105: 21% eclipse bloodlust
0:35.028 sunfire Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:36.051 wrath Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:37.413 wrath Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:38.774 starsurge Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:39.797 wrath Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, solar_empowerment(3)
0:41.158 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
0:42.928 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
0:42.928 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
0:44.698 starsurge Fluffy_Pillow 160000.0/160000: 100% mana solar_peak
0:46.025 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak, solar_empowerment(3)
0:47.352 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
0:49.121 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
0:50.891 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
0:52.660 wrath Fluffy_Pillow 160000.0/160000: 100% mana
0:54.429 starfire Fluffy_Pillow 160000.0/160000: 100% mana
0:57.083 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 33.7/105: 32% eclipse
0:58.411 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 53.6/105: 51% eclipse lunar_empowerment(2)
0:59.740 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 71.2/105: 68% eclipse lunar_empowerment(2)
1:02.392 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 96.3/105: 92% eclipse lunar_empowerment
1:05.044 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse lunar_peak
1:05.044 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse lunar_peak
1:07.694 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 95.7/105: 91% eclipse lunar_peak
1:10.345 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 70.1/105: 67% eclipse
1:11.674 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 52.4/105: 50% eclipse lunar_empowerment(2)
1:14.324 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 11.1/105: 11% eclipse lunar_empowerment
1:16.093 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
1:17.862 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
1:19.631 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
1:21.402 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
1:22.730 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(3)
1:24.499 sunfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_peak, solar_empowerment(2)
1:25.825 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(2)
1:25.825 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(2)
1:27.594 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment
1:29.365 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
1:30.691 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(3)
1:32.460 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(2)
1:34.228 starfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment
1:36.880 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 30.6/105: 29% eclipse solar_empowerment
1:38.208 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 50.7/105: 48% eclipse lunar_empowerment(2), solar_empowerment
1:39.534 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 68.6/105: 65% eclipse lunar_empowerment(2), solar_empowerment
1:42.187 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 94.9/105: 90% eclipse lunar_empowerment, solar_empowerment
1:44.839 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 105.0/105: 100% eclipse lunar_peak, solar_empowerment
1:46.164 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 103.2/105: 98% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment
1:46.164 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.2/105: 98% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment
1:48.816 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 86.7/105: 83% eclipse lunar_empowerment, solar_empowerment
1:51.468 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 55.3/105: 53% eclipse solar_empowerment
1:52.796 Waiting 0.500 sec 160000.0/160000: 100% mana | 35.6/105: 34% eclipse lunar_empowerment(2), solar_empowerment
1:53.296 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 27.8/105: 26% eclipse lunar_empowerment(2), solar_empowerment
1:55.065 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:56.836 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:58.606 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
1:59.933 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
2:01.703 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(2)
2:03.471 sunfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_peak, solar_empowerment
2:04.799 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
2:06.569 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:06.569 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:07.896 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(3)
2:09.665 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment(2)
2:11.434 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2), solar_empowerment
2:13.202 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:14.971 starfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment(2)
2:17.620 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 42.0/105: 40% eclipse lunar_empowerment
2:18.947 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 61.0/105: 58% eclipse lunar_empowerment, nightmare_fire
2:21.598 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 90.4/105: 86% eclipse nightmare_fire
2:22.925 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 99.5/105: 95% eclipse lunar_empowerment(2), nightmare_fire
2:25.576 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.6/105: 100% eclipse lunar_empowerment, lunar_peak, nightmare_fire
2:28.227 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 91.8/105: 87% eclipse nightmare_fire
2:28.227 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 91.8/105: 87% eclipse nightmare_fire
2:29.553 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 79.3/105: 75% eclipse lunar_empowerment(2), nightmare_fire
2:32.206 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 44.6/105: 42% eclipse lunar_empowerment, nightmare_fire
2:34.858 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 2.3/105: 2% eclipse nightmare_fire
2:36.627 wrath Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
2:38.396 wrath Fluffy_Pillow 160000.0/160000: 100% mana
2:40.164 wrath Fluffy_Pillow 160000.0/160000: 100% mana
2:41.933 wrath Fluffy_Pillow 160000.0/160000: 100% mana
2:43.703 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak
2:45.030 starsurge Fluffy_Pillow 160000.0/160000: 100% mana
2:46.356 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3)
2:48.125 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2)
2:49.895 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
2:49.895 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment
2:51.663 wrath Fluffy_Pillow 160000.0/160000: 100% mana
2:53.433 starfire Fluffy_Pillow 160000.0/160000: 100% mana
2:56.086 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 17.8/105: 17% eclipse
2:57.414 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 38.9/105: 37% eclipse
3:00.064 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 75.0/105: 71% eclipse
3:02.718 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 98.3/105: 94% eclipse
3:05.369 celestial_alignment Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse lunar_peak
3:05.369 potion Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, lunar_peak
3:05.369 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, lunar_peak, draenic_intellect_potion
3:08.019 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, lunar_peak, draenic_intellect_potion
3:09.346 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, draenic_intellect_potion
3:11.996 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, draenic_intellect_potion
3:11.996 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, draenic_intellect_potion
3:14.649 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, draenic_intellect_potion
3:17.301 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, draenic_intellect_potion
3:18.628 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse celestial_alignment, lunar_empowerment(2), draenic_intellect_potion
3:21.279 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 102.9/105: 98% eclipse lunar_empowerment, draenic_intellect_potion
3:23.930 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 85.6/105: 82% eclipse draenic_intellect_potion
3:25.257 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 71.2/105: 68% eclipse lunar_empowerment(2), draenic_intellect_potion
3:27.909 Waiting 0.400 sec 160000.0/160000: 100% mana | 33.9/105: 32% eclipse lunar_empowerment, draenic_intellect_potion
3:28.309 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 27.6/105: 26% eclipse lunar_empowerment, draenic_intellect_potion
3:30.078 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, draenic_intellect_potion
3:31.847 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
3:33.616 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
3:33.616 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
3:34.943 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(3)
3:36.714 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(2)
3:38.483 sunfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_peak, solar_empowerment
3:39.811 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment
3:41.580 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
3:43.350 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
3:45.118 starsurge Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment
3:46.446 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(3)
3:48.215 wrath Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment(2)
3:49.986 starfire Fluffy_Pillow 160000.0/160000: 100% mana lunar_empowerment, solar_empowerment
3:52.637 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 42.3/105: 40% eclipse solar_empowerment
3:53.964 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 61.2/105: 58% eclipse lunar_empowerment(2), solar_empowerment
3:53.964 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 61.2/105: 58% eclipse lunar_empowerment(2), solar_empowerment
3:56.615 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 90.5/105: 86% eclipse lunar_empowerment, solar_empowerment
3:57.942 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 99.6/105: 95% eclipse lunar_empowerment, solar_empowerment
4:00.593 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 104.5/105: 100% eclipse lunar_peak, solar_empowerment
4:01.920 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 100.3/105: 95% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment
4:04.570 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 79.1/105: 75% eclipse lunar_empowerment, solar_empowerment
4:07.220 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 44.4/105: 42% eclipse solar_empowerment
4:09.873 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 2.1/105: 2% eclipse solar_empowerment
4:11.642 wrath Fluffy_Pillow 160000.0/160000: 100% mana
4:13.412 starsurge Fluffy_Pillow 160000.0/160000: 100% mana
4:14.740 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3), nightmare_fire
4:14.740 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3), nightmare_fire
4:16.510 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2), nightmare_fire
4:18.279 sunfire Fluffy_Pillow 160000.0/160000: 100% mana solar_peak, solar_empowerment, nightmare_fire
4:19.606 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment, nightmare_fire
4:21.375 starsurge Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:22.701 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(3), nightmare_fire
4:24.470 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment(2), nightmare_fire
4:26.239 wrath Fluffy_Pillow 160000.0/160000: 100% mana solar_empowerment, nightmare_fire
4:28.008 wrath Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:29.778 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:29.778 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:29.778 starfire Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:32.428 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 39.1/105: 37% eclipse nightmare_fire
4:35.080 force_of_nature Fluffy_Pillow 160000.0/160000: 100% mana | 75.2/105: 72% eclipse
4:35.080 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 75.2/105: 72% eclipse
4:36.405 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 88.7/105: 84% eclipse lunar_empowerment(2)
4:37.730 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 98.4/105: 94% eclipse lunar_empowerment(2)
4:40.382 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 104.8/105: 100% eclipse lunar_empowerment, lunar_peak
4:43.033 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 93.3/105: 89% eclipse lunar_peak
4:44.361 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 81.3/105: 77% eclipse lunar_empowerment(2)
4:47.011 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 47.5/105: 45% eclipse lunar_empowerment
4:49.661 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 5.6/105: 5% eclipse

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 653 622 622
Agility 1352 1288 1288
Stamina 4063 3694 3694
Intellect 3870 3423 3313 (2219)
Spirit 782 782 782
Health 243780 221640 0
Mana 160000 160000 0
Eclipse 105 105 0
Spell Power 5311 4381 958
Crit 13.48% 8.48% 383
Haste 13.29% 7.90% 683
Multistrike 11.47% 6.47% 427
Damage / Heal Versatility 5.76% 2.76% 359
ManaReg per Second 2325 640 0
Mastery 44.16% 32.53% 1029
Armor 2616 872 872

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Ysera's Gift Renewal Cenarion Ward
45 Faerie Swarm (Balance Druid) Mass Entanglement Typhoon
60 Soul of the Forest Incarnation: Chosen of Elune Force of Nature
75 Incapacitating Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil
100 Euphoria Stellar Flare Balance of Power

Profile

druid="Ciaran"
origin="http://eu.battle.net/wow/en/character/forscherliga/Ciaran/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/225/94028513-avatar.jpg"
level=100
race=night_elf
role=spell
position=back
professions=leatherworking=14/skinning=289
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ua!0022022
glyphs=guided_stars/rebirth/stars/chameleon/stag
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/stellar_flare

# Executed every time the actor is available.

actions=potion,name=draenic_intellect,if=buff.celestial_alignment.up
actions+=/blood_fury,if=buff.celestial_alignment.up
actions+=/berserking,if=buff.celestial_alignment.up
actions+=/arcane_torrent,if=buff.celestial_alignment.up
actions+=/force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
actions+=/call_action_list,name=single_target,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.single_target=starsurge,if=buff.lunar_empowerment.down&eclipse_energy>20
actions.single_target+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
actions.single_target+=/starsurge,if=(charges=2&recharge_time<6)|charges=3
actions.single_target+=/celestial_alignment,if=eclipse_energy>40
actions.single_target+=/incarnation,if=eclipse_energy>0
actions.single_target+=/sunfire,if=remains<7|buff.solar_peak.up
actions.single_target+=/stellar_flare,if=remains<7
actions.single_target+=/moonfire,if=buff.lunar_peak.up&remains<eclipse_change+20|remains<4|(buff.celestial_alignment.up&buff.celestial_alignment.remains<=2&remains<eclipse_change+20)
actions.single_target+=/wrath,if=(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.single_target+=/starfire,if=(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)

actions.aoe=celestial_alignment,if=lunar_max<8|target.time_to_die<20
actions.aoe+=/incarnation,if=buff.celestial_alignment.up
actions.aoe+=/sunfire,cycle_targets=1,if=remains<8
actions.aoe+=/starfall,if=!buff.starfall.up&active_enemies>2
actions.aoe+=/starsurge,if=(charges=2&recharge_time<6)|charges=3
actions.aoe+=/moonfire,cycle_targets=1,if=remains<12
actions.aoe+=/stellar_flare,cycle_targets=1,if=remains<7
actions.aoe+=/starsurge,if=buff.lunar_empowerment.down&eclipse_energy>20&active_enemies=2
actions.aoe+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40&active_enemies=2
actions.aoe+=/wrath,if=(eclipse_energy<=0&eclipse_change>cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.aoe+=/starfire,if=(eclipse_energy>=0&eclipse_change>cast_time)|(eclipse_energy<0&cast_time>eclipse_change)

head=alloyinlaid_cap,id=116212
neck=cratermaker_choker,id=116285
shoulders=supple_shoulderguards,id=116176,bonus_id=48/525/536
back=brilliant_hexweave_cloak,id=114819,bonus_id=170/525/537,enchant=gift_of_mastery
chest=witherleaf_chestguard,id=120088
wrists=bracers_of_determined_resolve,id=114494,bonus_id=114/560/563,gems=50mastery
hands=exceptional_crystalhide_grips,id=115388
waist=cord_of_ruination,id=115430
legs=blackwater_leggings,id=109823,bonus_id=524
feet=boots_of_determined_resolve,id=114502,bonus_id=41/102/560
finger1=darkflame_loop,id=109766,bonus_id=524,enchant=30mastery
finger2=timeless_solium_band_of_the_archmage,id=118296,enchant=50mastery
trinket1=emblem_of_gushing_wounds,id=116290
trinket2=sandmans_pouch,id=112320,bonus_id=525/529
main_hand=spire_of_the_furious_construct,id=110031,bonus_id=41/524,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_stamina=2804
# gear_intellect=2219
# gear_spell_power=958
# gear_crit_rating=383
# gear_haste_rating=683
# gear_mastery_rating=980
# gear_armor=872
# gear_multistrike_rating=427
# gear_versatility_rating=359
# gear_leech_rating=182

Kernoris

Kernoris : 21207 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
21206.8 21206.8 9.2 / 0.043% 2921.4 / 13.8% 1338.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.8 15.8 Energy 39.26% 39.2 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Kernoris/advanced
Talents
  • 15: Wild Charge
  • 30: Ysera's Gift
  • 45: Typhoon
  • 60: Soul of the Forest (Feral Druid)
  • 75: Mighty Bash
  • 90: Dream of Cenarius (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Glyphs
  • Glyph of Savage Roar
  • Glyph of Cat Form
  • Glyph of Ferocious Bite
  • Glyph of Grace
  • Glyph of Travel
  • Glyph of Aquatic Form
Professions
  • alchemy: 700
  • herbalism: 700

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Kernoris+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:135432|76278|46124|28483|13014|5319&chds=0,270865&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++135432++rip,C79C6E,0,0,15|t++76278++ferocious_bite,C79C6E,1,0,15|t++46124++rake,C79C6E,2,0,15|t++28483++thrash_cat,C79C6E,3,0,15|t++13014++shred,C79C6E,4,0,15|t++5319++cat_melee,C79C6E,5,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Kernoris+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:25,20,20,17,17,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=cat_melee|shred|rip|rake|ferocious_bite|thrash_cat&
http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Kernoris+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:eimoqvy258777565322xurppomkjiijiijjjjjjjjjjiihgfedcccdddefeffffffgggggffeedcbaaaZaabbccdddeeedddeeeeeeddccbbaaaaabbccccccddddddddeeeeedddddddccccdddddddddddddddddddddcccccccbbccdefghijkmnoppqrrsssrqponnmlkjiiiiiiihhhhhhiihhhhhhggffeeeefffggghhiiiiiijjjjjjjjjiiihhhhhhiiijjkkllllllllllllkkjjjiihhhhhiijjjkkllmmmmmmmmmmlllkkkjjiiijkkllllllmmmllllllkkjihggffeedddddbaYWVTSRPO&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.57482,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=21207|max=36893&chxp=1,1,57,100 http://4.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Kernoris+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,1,1,3,8,17,29,47,95,141,222,327,437,589,809,1043,1283,1356,1557,1650,1791,1756,1676,1544,1467,1343,1118,988,817,645,568,403,347,266,179,143,91,82,50,44,21,23,11,8,1,0,1,0,0,1&chds=0,1791&chbh=5&chxt=x&chxl=0:|min=18413|avg=21207|max=24784&chxp=0,1,44,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Kernoris+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:32.6,9.3,7.8,4.6,3.1,2.6,0.8,39.3&chds=0,100&chdls=ffffff&chco=C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=shred 98.1s|healing_touch 28.1s|rake 23.4s|ferocious_bite 14.0s|rip 9.4s|savage_roar 7.7s|thrash_cat 2.5s|waiting 118.1s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Kernoris 21207
cat_melee 5321 25.1% 351.6 0.85sec 4549 5319 Direct 351.6 3323 6647 4292 29.1% 70.0 997 1994 29.2%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 351.55 351.55 0.00 0.00 0.8552 0.0000 1599112.03 2457582.71 34.93 5319.03 5319.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 20.42 29.17% 1994.05 1323 2589 1995.19 1852 2305 40712 62568 34.93
multistrike 49.59 70.83% 997.15 661 1295 997.71 944 1086 49446 75990 34.93
hit 249.08 70.85% 3323.50 2205 4316 3325.40 3263 3402 827821 1272231 34.93
crit 102.47 29.15% 6646.96 4410 8632 6650.85 6429 6984 681133 1046794 34.93
 
DPS Timeline Chart
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
ferocious_bite 3566 16.7% 13.9 21.80sec 76618 76278 Direct 13.9 45720 91468 72339 58.2% 2.7 13694 27427 58.2%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.91 13.91 0.00 0.00 1.0045 0.0000 1065835.09 1638020.24 34.93 76278.19 76278.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.60 58.16% 27427.09 1947 36936 22055.52 0 36936 43794 67305 28.08
multistrike 1.15 41.84% 13694.10 1012 18468 9412.57 0 18468 15732 24177 24.00
hit 5.82 41.82% 45719.96 3242 61559 45773.62 0 61559 265958 408735 34.90
crit 8.09 58.18% 91467.93 6474 123119 91646.89 59533 123119 740351 1137803 34.93
 
DPS Timeline Chart
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.health.pct<25
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point{$?s67598=true}[, consumes up to 25 additional Energy to increase damage by up to 100%, and heals you for $67598m1% of your total maximum health for each $67598m2 Energy used.][ and consumes up to 25 additional Energy to increase damage by up to 100%.]{$?s1079=true}[ When used on targets below 25% health, Ferocious Bite will also refresh the duration of your Rip on your target.][] Critical strike chance doubled against bleeding targets. 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.400000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
rake 3589 16.9% 23.3 13.04sec 46331 46124 Direct 23.3 6335 12661 8182 29.2% 4.6 1902 3799 29.3%  
Periodic 99.0 6457 12919 8344 29.2% 19.7 1981 3967 29.2% 98.7%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.27 23.27 99.01 99.01 1.0045 3.0000 1078291.78 1078291.78 0.00 3365.50 46124.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.35 29.28% 3799.47 1873 8691 2809.36 0 8691 5146 5146 0.00
multistrike 3.27 70.72% 1901.81 937 4346 1835.16 0 4346 6222 6222 0.00
hit 16.48 70.80% 6335.04 3122 14486 6349.51 5260 7628 104385 104385 0.00
crit 6.80 29.20% 12660.87 6244 28971 12680.11 0 28971 86046 86046 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.7 29.20% 3966.58 2622 8691 3955.39 0 8691 22808 22808 0.00
multistrike 13.9 70.80% 1981.28 1311 4346 1984.47 1508 3153 27624 27624 0.00
hit 70.1 70.81% 6457.49 2 14486 6467.78 5756 7218 452716 452716 0.00
crit 28.9 29.19% 12918.78 4 28971 12940.08 10000 16445 373345 373345 0.00
 
DPS Timeline Chart
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}. Awards {$s2=1} combo $lpoint:points;. If used while stealthed, the target will be stunned for {$163505d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.400000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
rip 4238 20.0% 9.4 25.02sec 136032 135432 Periodic 142.8 6529 13056 8431 29.1% 28.5 1959 3917 29.1% 94.9%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.38 9.38 142.85 142.85 1.0045 2.0000 1276313.73 1276313.73 0.00 4324.79 135432.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.3 29.10% 3917.05 2817 5370 3913.91 0 5370 32443 32443 0.00
multistrike 20.2 70.90% 1958.82 1409 2685 1957.75 1561 2434 39529 39529 0.00
hit 101.2 70.86% 6529.38 3492 8950 6526.01 5536 7104 660950 660950 0.00
crit 41.6 29.14% 13056.34 5921 17900 13049.70 10960 14662 543393 543393 0.00
 
DPS Timeline Chart
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<3&target.time_to_die-remains>18
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>)*8} damage 2 points: ${$floor(2*$<rip>)*8} damage 3 points: ${$floor(3*$<rip>)*8} damage 4 points: ${$floor(4*$<rip>)*8} damage 5 points: ${$floor(5*$<rip>)*8} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.086000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shred 4260 20.1% 97.7 3.08sec 13072 13014 Direct 97.7 9550 19100 12336 29.2% 19.5 2864 5730 29.1%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.69 97.69 0.00 0.00 1.0045 0.0000 1276998.47 1962545.02 34.93 13014.00 13014.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.67 29.14% 5730.35 3556 9049 5709.84 0 9049 32490 49932 34.78
multistrike 13.78 70.86% 2864.14 1778 4524 2866.51 2489 3545 39480 60674 34.93
hit 69.19 70.83% 9549.88 5927 15081 9558.74 8998 10204 660749 1015466 34.93
crit 28.50 29.17% 19099.65 11853 30162 19111.84 17291 21250 544280 836473 34.93
 
DPS Timeline Chart
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<3
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target{$?s48484=false}[ and reducing the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}][]. Awards {$s2=1} combo $lpoint:points;. Being stealthed increases damage by $5215m4% and doubles critical strike chance. Damage increased by {$106785s2=20}% against bleeding targets.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.00
 
thrash_cat 233 1.1% 2.4 62.77sec 28603 28483 Direct 2.4 4620 9238 5965 29.1% 0.5 1386 2770 29.3%  
Periodic 12.1 3304 6602 4267 29.2% 2.4 992 1983 29.2% 12.0%

Stats details: thrash_cat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.45 2.45 12.07 12.07 1.0045 3.0000 70067.89 70067.89 0.00 1812.27 28482.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.14 29.31% 2769.80 2065 3936 368.57 0 3936 397 397 0.00
multistrike 0.35 70.69% 1385.67 1033 1968 397.84 0 1968 479 479 0.00
hit 1.74 70.87% 4619.91 3442 6560 3867.34 0 6560 8021 8021 0.00
crit 0.71 29.13% 9238.18 6885 13120 4802.01 0 13120 6592 6592 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.7 29.21% 1982.86 1476 2812 928.08 0 2812 1394 1394 0.00
multistrike 1.7 70.79% 991.52 738 1406 722.33 0 1406 1689 1689 0.00
hit 8.5 70.79% 3303.81 2460 4687 3059.96 0 4687 28224 28224 0.00
crit 3.5 29.21% 6602.27 4919 9374 5793.26 0 9374 23273 23273 0.00
 
DPS Timeline Chart
 

Action details: thrash_cat

Static Values
  • id:106830
  • school:physical
  • resource:energy
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.omen_of_clarity.react&remains<4.5&active_enemies>1
Spelldata
  • id:106830
  • name:Thrash
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 sec.
  • description:Strikes all enemy targets within $A2 yards, dealing $m1 bleed damage and an additional $o2 damage over {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.315000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.225000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Kernoris
berserk 2.0 183.38sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.43 71.12% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.58 28.88% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: berserk

Static Values
  • id:106952
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106952
  • name:Berserk
  • school:physical
  • tooltip:
  • description:When used in Bear Form, removes the cooldown from Mangle and causes it to hit up to {$50334s1=3} targets and lasts {$50334d=10 seconds}. When used in Cat Form, reduces the cost of all Cat Form abilities by {$106951s1=50}% and lasts {$106951d=15 seconds}.
 
cat_form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.71 71.02% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.29 28.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:2368.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}%.$?$w2=100, and reduces falling damage.[ Additionally, all healing done to you is increased by {$47180s1=20}%][]
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}% and allowing the use of Cat Form abilities. Also protects the caster from Polymorph effects and reduces damage taken from falling.{$?s47180=true}[ Additionally, all healing done to you is increased by {$47180s1=20}%.][] The act of shapeshifting frees the caster of movement impairing effects.
 
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
healing_touch 29.0 10.59sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 28.97 28.97 0.00 0.00 0.9698 0.0000 0.00 966455.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.84 31.97% 0.00 0 0 0.00 0 0 0 26472 84.45
multistrike 3.92 68.03% 0.00 0 0 0.00 0 0 0 28184 97.94
hit 19.65 67.83% 0.00 0 0 0.00 0 0 0 467949 100.00
crit 9.32 32.17% 0.00 0 0 0.00 0 0 0 443850 100.00
 
HPS Timeline Chart
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3312.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Kernoris
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}{$?s54825=false}[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}[ Healing increased by 50% when cast on self.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.600000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
leader_of_the_pack 39.5 7.69sec

Stats details: leader_of_the_pack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 39.47 39.47 0.00 0.00 0.0000 0.0000 0.00 328687.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.47 100.00% 0.00 0 0 0.00 0 0 0 328687 100.00
 
HPS Timeline Chart
 

Action details: leader_of_the_pack

Static Values
  • id:68285
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kernoris
  • harmful:false
  • if_expr:
Spelldata
  • id:68285
  • name:Leader of the Pack
  • school:physical
  • tooltip:
  • description:{$@spelldesc17007=While in Bear Form or Cat Form, increases critical strike chance of all party and raid members within $24932a1 yards by {$24932s1=5}%. Also causes your melee critical strikes to heal you for {$68285s1=3}% of your health. This effect cannot occur more than once every 6 sec.}
 
savage_roar 7.7 37.55sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.66 7.66 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 7.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.savage_roar.remains<3
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by {$62071s1=40}% while in Cat Form. Lasts longer per combo point: 1 point : ${18+$<bonus>} seconds 2 points: ${24+$<bonus>} seconds 3 points: ${30+$<bonus>} seconds 4 points: ${36+$<bonus>} seconds 5 points: ${42+$<bonus>} seconds
 
tigers_fury 10.2 30.55sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.23 10.23 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.25 70.92% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.97 29.08% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.omen_of_clarity.react&energy.max-energy>=60)|energy.max-energy>=80
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Increases physical damage done by {$s1=15}%.
  • description:Increases physical damage done by {$s1=15}% for {$d=8 seconds} and instantly restores {$s2=60} Energy.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
berserk 2.0 0.0 183.4sec 183.4sec 10.15% 17.33% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserk_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106952
  • name:Berserk
  • tooltip:
  • description:When used in Bear Form, removes the cooldown from Mangle and causes it to hit up to {$50334s1=3} targets and lasts {$50334d=10 seconds}. When used in Cat Form, reduces the cost of all Cat Form abilities by {$106951s1=50}% and lasts {$106951d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 42.87% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bloodtalons 29.0 0.0 10.5sec 10.6sec 38.00% 38.58% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodtalons_1:22.64%
  • bloodtalons_2:15.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=30}% additional damage.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=30}% additional damage.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
draenic_agility_potion 2.0 0.0 258.5sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
omen_of_clarity (omen_of_clarity) 20.1 0.4 14.3sec 14.0sec 3.97% 13.62% 0.4(0.4)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_omen_of_clarity
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • omen_of_clarity_1:3.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Your next Cat Form ability has {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your autoattacks have a chance to reduce the Energy cost of your next Cat Form ability by {$16870s1=100}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
predatory_swiftness 28.6 0.8 10.5sec 10.2sec 61.56% 100.00% 0.8(0.8)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • predatory_swiftness_1:61.56%

Trigger Attempt Success

  • trigger_pct:95.26%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms, and heal for {$s4=20}% more.
  • description:{$@spelldesc16974=Your finishing moves have a $b3% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms, and to increase the healing done by Healing Touch by {$69369s4=20}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.13% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.$?$w2>=0[][ Movement speed slowed by $w2%.]
  • description:Activates Cat Form and places the Druid into stealth{$?s157274=false}[][, but reduces movement speed by {$s2=30}%]. Lasts until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
tigers_fury 10.2 0.0 30.5sec 30.5sec 26.85% 29.35% 0.0(0.0)

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Increases physical damage done by {$s1=15}%.
  • description:Increases physical damage done by {$s1=15}% for {$d=8 seconds} and instantly restores {$s2=60} Energy.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
cat_form

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • cat_form_1:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}%.$?$w2=100, and reduces falling damage.[ Additionally, all healing done to you is increased by {$47180s1=20}%][]
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}% and allowing the use of Cat Form abilities. Also protects the caster from Polymorph effects and reduces damage taken from falling.{$?s47180=true}[ Additionally, all healing done to you is increased by {$47180s1=20}%.][] The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
savage_roar

Buff details

  • buff initial source:Kernoris
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • savage_roar_1:99.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by {$62071s1=40}% while in Cat Form. Lasts longer per combo point: 1 point : ${18+$<bonus>} seconds 2 points: ${24+$<bonus>} seconds 3 points: ${30+$<bonus>} seconds 4 points: ${36+$<bonus>} seconds 5 points: ${42+$<bonus>} seconds
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Snapshotting Details

Ability Tiger's Fury Bloodtalons
Name Execute % Benefit % Execute % Benefit %
ferocious_bite36.05 %36.05 % 85.98 %85.98 %
rake37.66 %48.09 % 81.49 %92.38 %
rip38.10 %39.34 % 84.88 %89.35 %
shred33.85 %33.85 % 16.66 %16.66 %
thrash_cat (_cat)23.76 %23.68 % 94.34 %94.51 %
Improved Rake
Execute %4.30 %
Benefit %4.49 %
Wasted Buffs0.00

Resources

Resource Usage Type Count Total Average RPE APR
Kernoris
ferocious_bite Energy 27.8 568.1 20.4 40.8 1876.3
rake Energy 23.3 686.3 29.5 29.5 1571.2
rip Energy 9.4 233.1 24.8 24.8 5475.1
savage_roar Energy 7.7 186.2 24.3 24.3 0.0
shred Energy 97.7 3082.0 31.5 31.5 414.3
Resource Gains Type Count Total Average Overflow
leader_of_the_pack Health 39.47 0.00 (0.00%) 0.00 328686.81 100.00%
yseras_gift Health 4.23 0.00 (0.00%) 0.00 46164.39 100.00%
healing_touch Health 34.74 0.00 (0.00%) 0.00 966455.36 100.00%
glyph_of_ferocious_bite Health 13.91 0.00 (0.00%) 0.00 271235.21 100.00%
energy_regen Energy 1025.97 3492.02 (64.29%) 3.40 24.31 0.69%
mp5_regen Mana 1025.97 0.00 (0.00%) 0.00 153872.54 100.00%
omen_of_clarity Energy 20.10 741.58 (13.65%) 36.90 0.00 0.00%
primal_fury Combo Points 35.29 35.29 (23.54%) 1.00 0.00 0.00%
rake Combo Points 23.27 19.97 (13.32%) 0.86 3.30 14.18%
shred Combo Points 97.69 94.69 (63.15%) 0.97 3.00 3.07%
soul_of_the_forest Energy 30.95 584.58 (10.76%) 18.89 4.73 0.80%
tigers_fury Energy 10.23 613.59 (11.30%) 60.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 15.59 15.80
Combo Points 0.50 0.49
Combat End Resource Mean Min Max
Mana 32000.00 32000.00 32000.00
Rage 0.00 0.00 0.00
Energy 21.11 0.00 99.35
Combo Points 2.59 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.1%
treant-Energy Cap 0.1%
treant-Energy Cap 0.1%
treant-Energy Cap 0.1%
treant-Energy Cap 0.1%

Procs

Count Interval
primal_fury 35.3 8.4sec

Statistics & Data Analysis

Fight Length
Sample Data Kernoris Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Kernoris Damage Per Second
Count 25000
Mean 21206.75
Minimum 18412.75
Maximum 24784.06
Spread ( max - min ) 6371.31
Range [ ( max - min ) / 2 * 100% ] 15.02%
Standard Deviation 743.0816
5th Percentile 20051.00
95th Percentile 22497.97
( 95th Percentile - 5th Percentile ) 2446.97
Mean Distribution
Standard Deviation 4.6997
95.00% Confidence Intervall ( 21197.54 - 21215.96 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4716
0.1 Scale Factor Error with Delta=300 4713
0.05 Scale Factor Error with Delta=300 18854
0.01 Scale Factor Error with Delta=300 471364
Distribution Chart
DPS(e)
Sample Data Kernoris Damage Per Second (Effective)
Count 25000
Mean 21206.75
Minimum 18412.75
Maximum 24784.06
Spread ( max - min ) 6371.31
Range [ ( max - min ) / 2 * 100% ] 15.02%
Damage
Sample Data Kernoris Damage
Count 25000
Mean 6366618.99
Minimum 4736725.33
Maximum 8412247.79
Spread ( max - min ) 3675522.46
Range [ ( max - min ) / 2 * 100% ] 28.87%
DTPS
Sample Data Kernoris Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Kernoris Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Kernoris Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Kernoris Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Kernoris Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Kernoris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data KernorisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Kernoris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 cat_form
9 0.00 wild_charge
A 0.00 displacer_beast,if=movement.distance>10
B 0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
C 1.00 rake,if=buff.prowl.up
D 1.00 auto_attack
E 0.00 skull_bash
F 0.00 force_of_nature,if=charges=3|trinket.proc.all.react|target.time_to_die<20
G 0.88 potion,name=draenic_agility,if=target.time_to_die<=40
H 0.00 blood_fury,sync=tigers_fury
I 0.00 berserking,sync=tigers_fury
J 0.00 arcane_torrent,sync=tigers_fury
K 10.23 tigers_fury,if=(!buff.omen_of_clarity.react&energy.max-energy>=60)|energy.max-energy>=80
L 0.00 incarnation,if=cooldown.berserk.remains<10&energy.time_to_max>1
M 0.12 potion,name=draenic_agility,sync=berserk,if=target.health.pct<25
N 2.01 berserk,if=buff.tigers_fury.up
O 0.32 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.health.pct<25
Keep Rip from falling off during execute range.
P 27.97 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=4|buff.predatory_swiftness.remains<1.5)
Q 4.49 savage_roar,if=buff.savage_roar.remains<3
R 0.00 thrash_cat,cycle_targets=1,if=buff.omen_of_clarity.react&remains<4.5&active_enemies>1
S 0.00 thrash_cat,cycle_targets=1,if=!talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
T 0.00 pool_resource,for_next=1
U 0.00 thrash_cat,cycle_targets=1,if=remains<4.5&active_enemies>1
V 0.00 call_action_list,name=finisher,if=combo_points=5
W 0.00 call_action_list,name=maintain
X 0.00 call_action_list,name=generator,if=combo_points<5
actions.finisher
# count action,conditions
Y 5.08 ferocious_bite,cycle_targets=1,max_energy=1,if=target.health.pct<25&dot.rip.ticking
Z 7.34 rip,cycle_targets=1,if=remains<3&target.time_to_die-remains>18
a 2.05 rip,cycle_targets=1,if=remains<7.2&persistent_multiplier>dot.rip.pmultiplier&target.time_to_die-remains>18
b 3.17 savage_roar,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)&buff.savage_roar.remains<12.6
c 8.51 ferocious_bite,max_energy=1,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)
actions.maintain
# count action,conditions
d 0.00 rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<3&combo_points<5&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
e 0.00 rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<4.5&combo_points<5&persistent_multiplier>dot.rake.pmultiplier&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
f 13.80 rake,cycle_targets=1,if=talent.bloodtalons.enabled&remains<4.5&combo_points<5&(!buff.predatory_swiftness.up|buff.bloodtalons.up|persistent_multiplier>dot.rake.pmultiplier)&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
g 2.45 thrash_cat,cycle_targets=1,if=talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
h 0.00 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<4.2&active_enemies<6&target.time_to_die-remains>tick_time*5
i 8.48 rake,cycle_targets=1,if=persistent_multiplier>dot.rake.pmultiplier&combo_points<5&active_enemies=1
actions.generator
# count action,conditions
j 0.00 swipe,if=active_enemies>=3
k 97.69 shred,if=active_enemies<3

Sample Sequence

013457CDkkKNZkkkPkckkPfckkkPkakkkkPbfkkKPcikkPkckkkPkZkfkPKikckkkkPQfkkPkKZkkkPfckkkPfZkQkKkkPfkQkkkPZfkPkckKkkPfakkkPbfkkPkcKNkkkkPfZkkkPkckkkPfckkkkPOKfkQkkkPYkkkkPfYkkKkQkGkfkPiYkkkPkbfkKkkPYik

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points
Pre food Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points
Pre healing_touch Kernoris 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 32000.0/32000: 100% mana | 100.0/100: 100% rage | 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodtalons(2), draenic_agility_potion
0:00.000 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodtalons(2), draenic_agility_potion
0:00.000 auto_attack Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 65.0/100: 65% energy | 2.0/5: 40% combo_points bloodtalons, draenic_agility_potion
0:01.005 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 79.7/100: 80% energy | 2.0/5: 40% combo_points bloodlust, bloodtalons, draenic_agility_potion
0:02.011 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.4/100: 54% energy | 4.0/5: 80% combo_points bloodlust, draenic_agility_potion
0:03.015 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 29.1/100: 29% energy | 5.0/5: 100% combo_points bloodlust, draenic_agility_potion
0:03.015 berserk Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.1/100: 89% energy | 5.0/5: 100% combo_points bloodlust, tigers_fury, draenic_agility_potion
0:03.015 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.1/150: 59% energy | 5.0/5: 100% combo_points bloodlust, berserk, tigers_fury, draenic_agility_potion
0:04.020 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 108.8/150: 73% energy | 0.0/5: 0% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:05.024 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 103.4/150: 69% energy | 1.0/5: 20% combo_points bloodlust, berserk, omen_of_clarity, tigers_fury, predatory_swiftness, draenic_agility_potion
0:06.029 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 118.1/150: 79% energy | 2.0/5: 40% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:07.032 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 112.8/150: 75% energy | 4.0/5: 80% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:08.037 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 127.5/150: 85% energy | 4.0/5: 80% combo_points bloodlust, berserk, bloodtalons(2), tigers_fury, draenic_agility_potion
0:09.042 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 122.2/150: 81% energy | 5.0/5: 100% combo_points bloodlust, berserk, bloodtalons, tigers_fury, draenic_agility_potion
0:10.048 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 131.9/150: 88% energy | 0.0/5: 0% combo_points bloodlust, berserk, tigers_fury, predatory_swiftness, draenic_agility_potion
0:11.051 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 126.5/150: 84% energy | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:12.058 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 121.3/150: 81% energy | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:13.062 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 135.9/150: 91% energy | 4.0/5: 80% combo_points bloodlust, berserk, bloodtalons(2), draenic_agility_potion
0:14.066 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 133.1/150: 89% energy | 5.0/5: 100% combo_points bloodlust, berserk, omen_of_clarity, bloodtalons, draenic_agility_potion
0:15.071 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 150.0/150: 100% energy | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:16.074 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 144.7/150: 96% energy | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:17.076 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 139.3/150: 93% energy | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, draenic_agility_potion
0:18.081 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, draenic_agility_potion
0:19.085 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 4.0/5: 80% combo_points bloodlust, bloodtalons(2), draenic_agility_potion
0:20.091 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 74.7/100: 75% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons
0:21.096 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 79.4/100: 79% energy | 0.0/5: 0% combo_points bloodlust, predatory_swiftness
0:22.099 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.1/100: 54% energy | 1.0/5: 20% combo_points bloodlust, predatory_swiftness
0:23.104 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 28.7/100: 29% energy | 2.0/5: 40% combo_points bloodlust, omen_of_clarity, predatory_swiftness
0:24.109 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 43.4/100: 43% energy | 3.0/5: 60% combo_points bloodlust, predatory_swiftness
0:25.112 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 18.1/100: 18% energy | 5.0/5: 100% combo_points bloodlust, predatory_swiftness
0:26.117 Waiting 3.600 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.8/100: 33% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons(2)
0:29.717 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.4/100: 85% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons(2)
0:30.722 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 95.1/100: 95% energy | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness
0:31.727 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 74.8/100: 75% energy | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness
0:32.732 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 49.5/100: 49% energy | 3.0/5: 60% combo_points bloodlust, predatory_swiftness
0:33.737 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 24.2/100: 24% energy | 5.0/5: 100% combo_points bloodlust, predatory_swiftness
0:33.737 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 84.2/100: 84% energy | 5.0/5: 100% combo_points bloodlust, tigers_fury, predatory_swiftness
0:34.742 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 98.9/100: 99% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), tigers_fury
0:35.746 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 83.5/100: 84% energy | 0.0/5: 0% combo_points bloodlust, bloodtalons, tigers_fury, predatory_swiftness
0:36.748 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 63.2/100: 63% energy | 2.0/5: 40% combo_points bloodlust, tigers_fury, predatory_swiftness
0:37.753 Waiting 0.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 37.9/100: 38% energy | 3.0/5: 60% combo_points bloodlust, tigers_fury, predatory_swiftness
0:37.953 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.8/100: 41% energy | 3.0/5: 60% combo_points bloodlust, tigers_fury, predatory_swiftness
0:38.958 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 15.5/100: 15% energy | 4.0/5: 80% combo_points bloodlust, tigers_fury, predatory_swiftness
0:39.964 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.2/100: 30% energy | 4.0/5: 80% combo_points bloodlust, omen_of_clarity, bloodtalons(2), tigers_fury
0:40.970 Waiting 3.900 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 44.9/100: 45% energy | 5.0/5: 100% combo_points bloodlust, bloodtalons, tigers_fury
0:44.870 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 88.8/100: 89% energy | 5.0/5: 100% combo_points bloodtalons
0:45.875 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 70.1/100: 70% energy | 0.0/5: 0% combo_points predatory_swiftness
0:46.881 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.4/100: 41% energy | 2.0/5: 40% combo_points omen_of_clarity, predatory_swiftness
0:47.886 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 52.7/100: 53% energy | 3.0/5: 60% combo_points predatory_swiftness
0:48.890 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 24.0/100: 24% energy | 4.0/5: 80% combo_points predatory_swiftness
0:49.893 Waiting 0.500 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 4.0/5: 80% combo_points bloodtalons(2)
0:50.393 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 4.0/5: 80% combo_points bloodtalons(2)
0:51.397 Waiting 1.642 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.2/100: 12% energy | 5.0/5: 100% combo_points bloodtalons
0:53.039 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.6/100: 31% energy | 5.0/5: 100% combo_points bloodtalons
0:54.044 Waiting 0.800 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.9/100: 32% energy | 0.0/5: 0% combo_points predatory_swiftness
0:54.844 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 0.0/5: 0% combo_points predatory_swiftness
0:55.850 Waiting 2.035 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.2/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness
0:57.885 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.1/100: 35% energy | 1.0/5: 20% combo_points predatory_swiftness
0:58.888 Waiting 2.610 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.4/100: 11% energy | 2.0/5: 40% combo_points predatory_swiftness
1:01.498 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
1:02.503 Waiting 1.152 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness
1:03.655 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 3.0/5: 60% combo_points predatory_swiftness
1:04.660 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 36.3/100: 36% energy | 3.0/5: 60% combo_points bloodtalons(2)
1:04.660 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 96.3/100: 96% energy | 3.0/5: 60% combo_points bloodtalons(2), tigers_fury
1:05.663 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 72.6/100: 73% energy | 4.0/5: 80% combo_points bloodtalons, tigers_fury
1:06.667 Waiting 4.000 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 43.9/100: 44% energy | 5.0/5: 100% combo_points tigers_fury
1:10.667 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 88.8/100: 89% energy | 5.0/5: 100% combo_points tigers_fury
1:11.672 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 70.1/100: 70% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
1:12.675 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.4/100: 41% energy | 1.0/5: 20% combo_points predatory_swiftness
1:13.681 Waiting 2.491 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.7/100: 13% energy | 2.0/5: 40% combo_points predatory_swiftness
1:16.172 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
1:17.177 Waiting 2.552 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness
1:19.729 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
1:20.732 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
1:21.737 Waiting 0.250 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.3/100: 23% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:21.987 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.1/100: 26% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:22.991 Waiting 0.600 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 28.4/100: 28% energy | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness
1:23.591 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.2/100: 35% energy | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness
1:24.597 Waiting 2.603 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.5/100: 11% energy | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness
1:27.200 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness
1:28.206 Waiting 2.551 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.1/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness
1:30.757 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
1:31.760 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
1:32.764 Waiting 1.550 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.3/100: 23% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:34.314 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:35.318 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons
1:35.318 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 72.0/100: 72% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons, tigers_fury
1:36.323 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 100.0/100: 100% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
1:37.327 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 71.3/100: 71% energy | 1.0/5: 20% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
1:38.329 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 82.6/100: 83% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
1:39.333 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 53.8/100: 54% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
1:40.338 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 65.1/100: 65% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
1:41.342 Waiting 4.300 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.4/100: 41% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
1:45.642 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.8/100: 90% energy | 5.0/5: 100% combo_points bloodtalons
1:46.647 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 71.1/100: 71% energy | 0.0/5: 0% combo_points predatory_swiftness
1:47.651 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 42.4/100: 42% energy | 2.0/5: 40% combo_points predatory_swiftness
1:48.655 Waiting 2.407 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 13.7/100: 14% energy | 3.0/5: 60% combo_points predatory_swiftness
1:51.062 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
1:52.066 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
1:53.070 Waiting 1.050 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.3/100: 23% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:54.120 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.1/100: 35% energy | 4.0/5: 80% combo_points bloodtalons(2)
1:55.125 Waiting 1.707 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.4/100: 11% energy | 5.0/5: 100% combo_points bloodtalons
1:56.832 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.6/100: 31% energy | 5.0/5: 100% combo_points bloodtalons
1:57.836 Waiting 0.800 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.9/100: 32% energy | 0.0/5: 0% combo_points predatory_swiftness
1:58.636 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 0.0/5: 0% combo_points predatory_swiftness
1:59.641 Waiting 1.238 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.2/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness
2:00.879 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.1/100: 26% energy | 1.0/5: 20% combo_points predatory_swiftness
2:01.884 Waiting 2.163 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 16.4/100: 16% energy | 0.0/5: 0% combo_points predatory_swiftness
2:04.047 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 0.0/5: 0% combo_points predatory_swiftness
2:05.051 Waiting 1.153 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness
2:06.204 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 1.0/5: 20% combo_points predatory_swiftness
2:06.204 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.0/100: 85% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
2:07.209 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 56.3/100: 56% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
2:08.214 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.6/100: 28% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
2:09.219 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.9/100: 39% energy | 3.0/5: 60% combo_points bloodtalons(2), tigers_fury
2:10.224 Waiting 2.271 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 15.2/100: 15% energy | 4.0/5: 80% combo_points bloodtalons, tigers_fury
2:12.495 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 4.0/5: 80% combo_points bloodtalons, tigers_fury
2:13.499 Waiting 2.454 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 5.0/5: 100% combo_points tigers_fury
2:15.953 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 39.6/100: 40% energy | 5.0/5: 100% combo_points
2:16.959 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 45.9/100: 46% energy | 0.0/5: 0% combo_points predatory_swiftness
2:17.963 Waiting 2.091 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 17.2/100: 17% energy | 2.0/5: 40% combo_points predatory_swiftness
2:20.054 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
2:21.058 Waiting 2.554 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 3.0/5: 60% combo_points predatory_swiftness
2:23.612 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
2:24.618 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.1/100: 12% energy | 5.0/5: 100% combo_points predatory_swiftness
2:25.621 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.3/100: 23% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons(2)
2:26.624 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.6/100: 55% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
2:27.628 Waiting 0.900 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.9/100: 31% energy | 2.0/5: 40% combo_points predatory_swiftness
2:28.528 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.0/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness
2:29.532 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.3/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
2:30.535 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.6/100: 24% energy | 4.0/5: 80% combo_points omen_of_clarity, bloodtalons(2)
2:31.540 Waiting 1.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 34.9/100: 35% energy | 5.0/5: 100% combo_points bloodtalons
2:33.240 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.0/100: 54% energy | 5.0/5: 100% combo_points bloodtalons
2:34.245 Waiting 0.500 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.3/100: 35% energy | 0.0/5: 0% combo_points predatory_swiftness
2:34.745 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.9/100: 41% energy | 0.0/5: 0% combo_points predatory_swiftness
2:35.750 Waiting 1.136 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.2/100: 12% energy | 2.0/5: 40% combo_points predatory_swiftness
2:36.886 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 2.0/5: 40% combo_points omen_of_clarity, predatory_swiftness
2:36.886 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 85.0/100: 85% energy | 2.0/5: 40% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
2:37.889 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 96.3/100: 96% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
2:38.893 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 67.6/100: 68% energy | 4.0/5: 80% combo_points tigers_fury, predatory_swiftness
2:39.896 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 78.8/100: 79% energy | 4.0/5: 80% combo_points bloodtalons(2), tigers_fury
2:40.902 Waiting 1.600 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 55.2/100: 55% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
2:42.502 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 73.1/100: 73% energy | 5.0/5: 100% combo_points bloodtalons, tigers_fury
2:43.508 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 74.5/100: 74% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
2:44.514 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 45.8/100: 46% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
2:45.517 Waiting 2.107 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 17.0/100: 17% energy | 3.0/5: 60% combo_points predatory_swiftness
2:47.624 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
2:48.629 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 5.0/5: 100% combo_points predatory_swiftness
2:49.633 Waiting 5.848 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.3/100: 23% energy | 5.0/5: 100% combo_points bloodtalons(2)
2:55.481 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.1/100: 89% energy | 5.0/5: 100% combo_points bloodtalons(2)
2:56.486 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 95.4/100: 95% energy | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness
2:57.490 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 71.7/100: 72% energy | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness
2:58.496 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 43.0/100: 43% energy | 2.0/5: 40% combo_points predatory_swiftness
2:59.500 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 14.3/100: 14% energy | 4.0/5: 80% combo_points predatory_swiftness
3:00.505 Waiting 1.300 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.6/100: 26% energy | 4.0/5: 80% combo_points bloodtalons(2)
3:01.805 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.2/100: 40% energy | 4.0/5: 80% combo_points bloodtalons(2)
3:02.808 Waiting 3.502 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.5/100: 11% energy | 5.0/5: 100% combo_points bloodtalons
3:06.310 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.9/100: 51% energy | 5.0/5: 100% combo_points bloodtalons
3:07.315 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.2/100: 32% energy | 0.0/5: 0% combo_points omen_of_clarity, predatory_swiftness
3:07.315 berserk Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 92.2/100: 92% energy | 0.0/5: 0% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
3:07.315 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 92.2/150: 61% energy | 0.0/5: 0% combo_points berserk, omen_of_clarity, tigers_fury, predatory_swiftness
3:08.319 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 103.4/150: 69% energy | 1.0/5: 20% combo_points berserk, tigers_fury, predatory_swiftness
3:09.324 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 94.7/150: 63% energy | 2.0/5: 40% combo_points berserk, tigers_fury, predatory_swiftness
3:10.329 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 86.0/150: 57% energy | 3.0/5: 60% combo_points berserk, tigers_fury, predatory_swiftness
3:11.334 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 77.3/150: 52% energy | 4.0/5: 80% combo_points berserk, tigers_fury, predatory_swiftness
3:12.338 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 88.6/150: 59% energy | 4.0/5: 80% combo_points berserk, bloodtalons(2), tigers_fury
3:13.342 rip Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 82.4/150: 55% energy | 5.0/5: 100% combo_points berserk, bloodtalons, tigers_fury
3:14.345 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 98.7/150: 66% energy | 0.0/5: 0% combo_points berserk, tigers_fury, predatory_swiftness
3:15.349 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 90.0/150: 60% energy | 2.0/5: 40% combo_points berserk, predatory_swiftness
3:16.353 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 81.3/150: 54% energy | 3.0/5: 60% combo_points berserk, predatory_swiftness
3:17.358 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 72.6/150: 48% energy | 4.0/5: 80% combo_points berserk, omen_of_clarity, predatory_swiftness
3:18.364 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 83.9/150: 56% energy | 4.0/5: 80% combo_points berserk, omen_of_clarity, bloodtalons(2)
3:19.370 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 95.2/150: 63% energy | 5.0/5: 100% combo_points berserk, bloodtalons
3:20.374 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 101.5/150: 68% energy | 0.0/5: 0% combo_points berserk, predatory_swiftness
3:21.379 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 92.8/150: 62% energy | 2.0/5: 40% combo_points berserk, predatory_swiftness
3:22.381 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 84.1/100: 84% energy | 3.0/5: 60% combo_points predatory_swiftness
3:23.386 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 55.4/100: 55% energy | 4.0/5: 80% combo_points predatory_swiftness
3:24.391 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 66.7/100: 67% energy | 4.0/5: 80% combo_points bloodtalons(2)
3:25.396 Waiting 4.100 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 43.0/100: 43% energy | 5.0/5: 100% combo_points bloodtalons
3:29.496 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 89.1/100: 89% energy | 5.0/5: 100% combo_points bloodtalons
3:30.500 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 70.4/100: 70% energy | 0.0/5: 0% combo_points predatory_swiftness
3:31.505 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.7/100: 42% energy | 1.0/5: 20% combo_points predatory_swiftness
3:32.509 Waiting 1.071 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.9/100: 13% energy | 2.0/5: 40% combo_points predatory_swiftness
3:33.580 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 2.0/5: 40% combo_points omen_of_clarity, predatory_swiftness
3:34.584 Waiting 0.400 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 36.3/100: 36% energy | 3.0/5: 60% combo_points predatory_swiftness
3:34.984 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.8/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness
3:35.990 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.1/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness
3:36.994 Waiting 0.244 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.4/100: 23% energy | 4.0/5: 80% combo_points bloodtalons(2)
3:37.238 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.1/100: 26% energy | 4.0/5: 80% combo_points bloodtalons(2)
3:38.243 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 27.3/100: 27% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
3:38.243 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 87.3/100: 87% energy | 0.0/5: 0% combo_points bloodtalons, tigers_fury, predatory_swiftness
3:39.247 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 63.6/100: 64% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
3:40.252 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 34.9/100: 35% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
3:41.256 Waiting 0.500 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 33.2/100: 33% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
3:41.756 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 38.8/100: 39% energy | 0.0/5: 0% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
3:42.760 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.1/100: 50% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
3:43.764 Waiting 1.721 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 21.4/100: 21% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
3:45.485 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
3:46.490 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 5.0/5: 100% combo_points predatory_swiftness
3:47.494 Waiting 2.449 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.3/100: 23% energy | 5.0/5: 100% combo_points bloodtalons(2)
3:49.943 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.9/100: 51% energy | 5.0/5: 100% combo_points bloodtalons(2)
3:50.949 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.2/100: 32% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
3:51.649 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.0/100: 40% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
3:52.654 Waiting 2.514 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.3/100: 11% energy | 1.0/5: 20% combo_points predatory_swiftness
3:55.168 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 39.6/100: 40% energy | 1.0/5: 20% combo_points omen_of_clarity, predatory_swiftness
3:56.173 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.9/100: 51% energy | 2.0/5: 40% combo_points omen_of_clarity, predatory_swiftness
3:57.178 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 62.2/100: 62% energy | 3.0/5: 60% combo_points predatory_swiftness
3:58.183 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 33.5/100: 34% energy | 4.0/5: 80% combo_points predatory_swiftness
3:59.187 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 44.8/100: 45% energy | 4.0/5: 80% combo_points bloodtalons(2)
4:00.192 Waiting 2.646 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 21.1/100: 21% energy | 5.0/5: 100% combo_points bloodtalons
4:02.838 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.9/100: 51% energy | 5.0/5: 100% combo_points bloodtalons
4:03.842 Waiting 0.700 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 32.1/100: 32% energy | 0.0/5: 0% combo_points predatory_swiftness
4:04.542 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.0/100: 40% energy | 0.0/5: 0% combo_points predatory_swiftness
4:05.545 Waiting 2.618 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.3/100: 11% energy | 1.0/5: 20% combo_points predatory_swiftness
4:08.163 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 1.0/5: 20% combo_points predatory_swiftness
4:09.168 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 2.0/5: 40% combo_points predatory_swiftness
4:09.168 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 72.0/100: 72% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
4:10.170 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 43.3/100: 43% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
4:11.172 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 41.6/100: 42% energy | 0.0/5: 0% combo_points tigers_fury, predatory_swiftness
4:12.178 Waiting 1.077 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.9/100: 13% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
4:13.255 potion Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 1.0/5: 20% combo_points omen_of_clarity, tigers_fury, predatory_swiftness
4:13.255 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.0/100: 25% energy | 1.0/5: 20% combo_points omen_of_clarity, tigers_fury, predatory_swiftness, draenic_agility_potion
4:14.259 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 36.3/100: 36% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness, draenic_agility_potion
4:15.264 Waiting 2.504 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.6/100: 13% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness, draenic_agility_potion
4:17.768 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 3.0/5: 60% combo_points predatory_swiftness, draenic_agility_potion
4:18.773 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness, draenic_agility_potion
4:19.777 Waiting 1.048 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.3/100: 23% energy | 4.0/5: 80% combo_points bloodtalons(2), draenic_agility_potion
4:20.825 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.1/100: 35% energy | 4.0/5: 80% combo_points bloodtalons(2), draenic_agility_potion
4:21.827 Waiting 1.711 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.4/100: 11% energy | 5.0/5: 100% combo_points bloodtalons, draenic_agility_potion
4:23.538 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 30.6/100: 31% energy | 5.0/5: 100% combo_points omen_of_clarity, bloodtalons, draenic_agility_potion
4:24.541 Waiting 0.300 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 36.9/100: 37% energy | 0.0/5: 0% combo_points predatory_swiftness, draenic_agility_potion
4:24.841 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.3/100: 40% energy | 0.0/5: 0% combo_points predatory_swiftness, draenic_agility_potion
4:25.846 Waiting 1.294 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.6/100: 12% energy | 1.0/5: 20% combo_points predatory_swiftness, draenic_agility_potion
4:27.140 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 26.1/100: 26% energy | 1.0/5: 20% combo_points omen_of_clarity, predatory_swiftness, draenic_agility_potion
4:28.144 Waiting 0.300 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 37.4/100: 37% energy | 2.0/5: 40% combo_points predatory_swiftness, draenic_agility_potion
4:28.444 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.8/100: 41% energy | 2.0/5: 40% combo_points predatory_swiftness, draenic_agility_potion
4:29.449 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.1/100: 12% energy | 4.0/5: 80% combo_points predatory_swiftness, draenic_agility_potion
4:30.453 Waiting 1.544 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 23.4/100: 23% energy | 4.0/5: 80% combo_points bloodtalons(2), draenic_agility_potion
4:31.997 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 4.0/5: 80% combo_points bloodtalons(2), draenic_agility_potion
4:33.002 Waiting 3.252 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.0/100: 12% energy | 5.0/5: 100% combo_points bloodtalons, draenic_agility_potion
4:36.254 savage_roar Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 48.6/100: 49% energy | 5.0/5: 100% combo_points bloodtalons, draenic_agility_potion
4:37.258 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 54.9/100: 55% energy | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, draenic_agility_potion
4:38.263 Waiting 0.800 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.2/100: 31% energy | 1.0/5: 20% combo_points predatory_swiftness
4:39.063 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.2/100: 40% energy | 1.0/5: 20% combo_points predatory_swiftness
4:40.068 tigers_fury Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 11.5/100: 11% energy | 2.0/5: 40% combo_points predatory_swiftness
4:40.068 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 71.5/100: 71% energy | 2.0/5: 40% combo_points tigers_fury, predatory_swiftness
4:41.072 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 42.8/100: 43% energy | 3.0/5: 60% combo_points tigers_fury, predatory_swiftness
4:42.078 healing_touch Kernoris 32000.0/32000: 100% mana | 0.0/100: 0% rage | 14.1/100: 14% energy | 5.0/5: 100% combo_points tigers_fury, predatory_swiftness
4:43.082 Waiting 2.200 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 25.4/100: 25% energy | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
4:45.282 ferocious_bite Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 50.1/100: 50% energy | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
4:46.289 Waiting 0.400 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 31.4/100: 31% energy | 0.0/5: 0% combo_points bloodtalons, tigers_fury, predatory_swiftness
4:46.689 rake Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 35.9/100: 36% energy | 0.0/5: 0% combo_points bloodtalons, tigers_fury, predatory_swiftness
4:47.694 Waiting 2.534 sec 32000.0/32000: 100% mana | 0.0/100: 0% rage | 12.2/100: 12% energy | 1.0/5: 20% combo_points tigers_fury, predatory_swiftness
4:50.228 shred Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/100: 0% rage | 40.7/100: 41% energy | 1.0/5: 20% combo_points predatory_swiftness

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 660 629 629
Agility 4009 3556 3451 (1204)
Stamina 3855 3505 3505
Intellect 1089 1038 1038
Spirit 781 781 781
Health 231300 210300 0
Mana 32000 32000 0
Rage 100 100 0
Energy 100 100 0
Combo Points 5 5 0
Crit 32.15% 26.19% 1121
Haste 12.44% 7.09% 709
Multistrike 9.95% 4.95% 327
Damage / Heal Versatility 5.56% 2.56% 333
ManaReg per Second 512 512 0
Attack Power 4410 3556 0
Mastery 49.61% 33.96% 313
Armor 816 816 816
Run Speed 0 0 95

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Ysera's Gift Renewal Cenarion Ward
45 Faerie Swarm (Feral Druid) Mass Entanglement Typhoon
60 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Force of Nature (Feral Druid)
75 Incapacitating Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild (Feral Druid) Dream of Cenarius (Feral Druid) Nature's Vigil
100 Lunar Inspiration (Feral Druid) Bloodtalons (Feral Druid) Claws of Shirvallah (Feral Druid)

Profile

druid="Kernoris"
origin="http://eu.battle.net/wow/en/character/forscherliga/Kernoris/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/20/55011348-avatar.jpg"
level=100
race=worgen
role=attack
position=back
professions=alchemy=700/herbalism=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#UZ!2020211
glyphs=savage_roar/cat_form/ferocious_bite/grace/travel/aquatic_form
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/force_of_nature,if=charges=3|trinket.proc.all.react|target.time_to_die<20
actions+=/potion,name=draenic_agility,if=target.time_to_die<=40
actions+=/blood_fury,sync=tigers_fury
actions+=/berserking,sync=tigers_fury
actions+=/arcane_torrent,sync=tigers_fury
actions+=/tigers_fury,if=(!buff.omen_of_clarity.react&energy.max-energy>=60)|energy.max-energy>=80
actions+=/incarnation,if=cooldown.berserk.remains<10&energy.time_to_max>1
actions+=/potion,name=draenic_agility,sync=berserk,if=target.health.pct<25
actions+=/berserk,if=buff.tigers_fury.up
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.health.pct<25
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=4|buff.predatory_swiftness.remains<1.5)
actions+=/savage_roar,if=buff.savage_roar.remains<3
actions+=/thrash_cat,cycle_targets=1,if=buff.omen_of_clarity.react&remains<4.5&active_enemies>1
actions+=/thrash_cat,cycle_targets=1,if=!talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
actions+=/pool_resource,for_next=1
actions+=/thrash_cat,cycle_targets=1,if=remains<4.5&active_enemies>1
actions+=/call_action_list,name=finisher,if=combo_points=5
actions+=/call_action_list,name=maintain
actions+=/call_action_list,name=generator,if=combo_points<5

actions.finisher=ferocious_bite,cycle_targets=1,max_energy=1,if=target.health.pct<25&dot.rip.ticking
actions.finisher+=/rip,cycle_targets=1,if=remains<3&target.time_to_die-remains>18
actions.finisher+=/rip,cycle_targets=1,if=remains<7.2&persistent_multiplier>dot.rip.pmultiplier&target.time_to_die-remains>18
actions.finisher+=/savage_roar,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)&buff.savage_roar.remains<12.6
actions.finisher+=/ferocious_bite,max_energy=1,if=(energy.time_to_max<=1|buff.berserk.up|cooldown.tigers_fury.remains<3)

actions.maintain=rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<3&combo_points<5&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
actions.maintain+=/rake,cycle_targets=1,if=!talent.bloodtalons.enabled&remains<4.5&combo_points<5&persistent_multiplier>dot.rake.pmultiplier&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
actions.maintain+=/rake,cycle_targets=1,if=talent.bloodtalons.enabled&remains<4.5&combo_points<5&(!buff.predatory_swiftness.up|buff.bloodtalons.up|persistent_multiplier>dot.rake.pmultiplier)&((target.time_to_die-remains>3&active_enemies<3)|target.time_to_die-remains>6)
actions.maintain+=/thrash_cat,cycle_targets=1,if=talent.bloodtalons.enabled&combo_points=5&remains<4.5&buff.omen_of_clarity.react
actions.maintain+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<4.2&active_enemies<6&target.time_to_die-remains>tick_time*5
actions.maintain+=/rake,cycle_targets=1,if=persistent_multiplier>dot.rake.pmultiplier&combo_points<5&active_enemies=1

actions.generator=swipe,if=active_enemies>=3
actions.generator+=/shred,if=active_enemies<3

head=crown_of_woe,id=118941
neck=mordant_gorget,id=119011,bonus_id=202/560,enchant=40crit
shoulders=bloodfeather_spaulders,id=109935,bonus_id=524
back=rotmelter_mosscloak,id=116294
chest=crystalbinder_chestguard,id=109886,bonus_id=42/524
shirt=undisputed_champions_shirt,id=98082
wrists=bloodfeather_bracers,id=109869,bonus_id=524
hands=bloodfeather_grips,id=109849,bonus_id=522
waist=springrain_belt,id=119513
legs=legguards_of_burning_focus,id=109809,bonus_id=524
feet=boots_of_determined_resolve,id=114502,bonus_id=30
finger1=timeless_solium_band_of_the_assassin,id=118297,enchant=30crit
finger2=ceds_chiming_circle,id=109760,bonus_id=523/524,gems=35crit,enchant=30crit
trinket1=bloodmaws_tooth,id=116289
trinket2=grandiose_plans,id=114549
main_hand=grandiose_polearm,id=115332,bonus_id=236

# Gear Summary
# gear_agility=2101
# gear_stamina=2615
# gear_crit_rating=1068
# gear_haste_rating=709
# gear_mastery_rating=313
# gear_armor=816
# gear_multistrike_rating=327
# gear_versatility_rating=333
# gear_speed_rating=95

Mekkasus

Mekkasus : 17780 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17780.2 17780.2 8.2 / 0.046% 2590.4 / 14.6% 857.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.9 10.9 Focus 0.00% 51.6 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Mekkasus/advanced
Talents
  • 15: Crouching Tiger, Hidden Chimaera
  • 30: Binding Shot
  • 45: Spirit Bond
  • 60: Dire Beast
  • 75: A Murder of Crows
  • 90: Glaive Toss
  • 100: Adaptation (Beast Mastery Hunter)
  • Talent Calculator
Glyphs
  • Glyph of Animal Bond
  • Glyph of Disengage
  • Glyph of Deterrence
  • Glyph of Tame Beast
  • Glyph of Fetch
  • Glyph of Stampede
Professions
  • alchemy: 602
  • herbalism: 693

Charts

http://3.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Mekkasus+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:111724|35506|30139|17842|13652|7789|2699|1760&chds=0,223447&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,69CCF0,ABD473,C79C6E&chm=t++111724++a_murder_of_crows,C79C6E,0,0,15|t++35506++dire_beast,C79C6E,1,0,15|t++30139++kill_shot,C79C6E,2,0,15|t++17842++kill_command,C79C6E,3,0,15|t++13652++glaive_toss,C79C6E,4,0,15|t++7789++arcane_shot,69CCF0,5,0,15|t++2699++cobra_shot,ABD473,6,0,15|t++1760++auto_shot,C79C6E,7,0,15& http://4.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Mekkasus+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:31,27,21,21,19,19,17,13,13,5,5&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,69CCF0,C79C6E,ABD473,C79C6E,C79C6E&chl=cat: melee|cat: kill_command|crow_peck|kill_shot|cat: claw|auto_shot|arcane_shot|dire_beast_1: dire_beast_melee|cobra_shot|glaive_2|glaive_1&
http://6.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Mekkasus+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:knprvz123556431yvtoolkihfeffffffffffffeeeeeddcbaaZYXXZabdegikmnooprsssssssrqomkihfedcbaZZaaaaaaaaaaaaaZZZZZZZYYYXXYZbcdfhjkmnopqrrrrrrrqpnmljhgeddcbaaabbbccccccccccccbbbbbbbbbbcdfgijlnpqstuwwxxxxxwvutsqpomlkjihhhhhiiiijjjjjjjjiiiiiiiihhiiklmoqstvxy01345666664310zxwutsrpnmlllllllllllkkkjjjjjiiihhhhijkmnprtuwxz134567877654210zxwvtsqponnnnnnmmllkkjjjiiiihggffffffdcaZXVUSRP&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.625796,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=17780|max=28412&chxp=1,1,63,100 http://9.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Mekkasus+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,2,4,8,12,24,42,72,87,130,167,242,352,451,611,709,817,1021,1195,1279,1460,1522,1649,1660,1612,1463,1405,1303,1136,939,827,706,532,480,288,233,179,133,82,55,44,22,22,11,7,1,0,0,1,2&chds=0,1660&chbh=5&chxt=x&chxl=0:|min=15284|avg=17780|max=20613&chxp=0,1,47,100& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Mekkasus+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:45.1,20.3,14.3,6.4,6.4,3.4,2.4,1.8&chds=0,100&chdls=ffffff&chco=ABD473,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=cobra_shot 135.6s|arcane_shot 61.0s|kill_command 43.0s|kill_shot 19.2s|glaive_toss 19.1s|dire_beast 10.3s|focus_fire 7.2s|a_murder_of_crows 5.4s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Mekkasus 17780
a_murder_of_crows 0 (2011) 0.0% (11.3%) 5.4 61.30sec 112217 111724

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 5.38 78.60 78.60 1.0045 1.0000 0.00 0.00 0.00 7184.39 111723.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.6 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target over the next {$d=15 seconds}. If the target dies while under attack, A Murder of Crows' cooldown is reset.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    crow_peck 2011 11.3% 0.0 0.00sec 0 0 Direct 78.6 5817 11860 7186 22.7% 17.9 1745 3560 22.7%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 78.60 0.00 0.00 0.0000 0.0000 603531.54 927532.69 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.07 22.70% 3560.03 2450 5415 3499.59 0 5027 14490 22269 34.30
multistrike 13.86 77.30% 1744.54 1201 2654 1747.10 1334 2227 24185 37169 34.93
hit 60.79 77.34% 5816.70 4003 8848 5824.29 4756 6718 353619 543457 34.93
crit 17.81 22.66% 11860.48 8165 18050 11876.38 9344 14372 211237 324637 34.93
 
DPS Timeline Chart
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.170000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
arcane_shot 1582 8.9% 60.8 4.88sec 7824 7789 Direct 60.6 5937 12110 7340 22.7% 13.9 1782 3632 22.7%  

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.75 60.60 0.00 0.00 1.0045 0.0000 475318.88 475318.88 0.00 7788.92 7788.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.15 22.72% 3632.15 2776 5348 3470.24 0 5348 11448 11448 0.00
multistrike 10.72 77.28% 1781.87 1361 2622 1782.09 0 2563 19098 19098 0.00
hit 46.83 77.28% 5937.34 4536 8739 5938.84 5357 6557 278046 278046 0.00
crit 13.77 22.72% 12110.35 9254 17828 12112.10 9619 15321 166727 166727 0.00
 
DPS Timeline Chart
 

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.thrill_of_the_hunt.react&focus>35)|buff.bestial_wrath.up
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:An instant shot that causes $sw2 Arcane damage.$?p131564[ Grants {$142978s1=122} PvP Power for {$142978d=6 seconds}.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.26
 
auto_shot 1757 9.9% 130.4 2.32sec 4050 1760 Direct 130.4 3067 6257 3790 22.7% 29.8 920 1877 22.6%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.38 130.38 0.00 0.00 2.3019 0.0000 528063.48 811550.19 34.93 1759.55 1759.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.74 22.59% 1876.82 1517 2933 1874.42 0 2866 12650 19442 34.88
multistrike 23.10 77.41% 920.19 743 1438 920.30 787 1070 21258 32669 34.93
hit 100.81 77.33% 3066.88 2478 4792 3067.72 2809 3272 309184 475167 34.93
crit 29.56 22.67% 6257.22 5055 9776 6257.77 5468 7134 184972 284272 34.93
 
DPS Timeline Chart
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
cobra_shot 1216 6.8% 86.7 3.33sec 4222 2699 Direct 86.4 3206 6541 3962 22.7% 19.8 962 1962 22.8%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.67 86.43 0.00 0.00 1.5645 0.0000 365935.33 365935.33 0.00 2698.72 2698.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.51 22.76% 1962.28 1666 3209 1940.21 0 2917 8843 8843 0.00
multistrike 15.30 77.24% 961.56 817 1573 961.97 829 1222 14709 14709 0.00
hit 66.85 77.35% 3205.96 2722 5243 3207.26 2939 3474 214313 214313 0.00
crit 19.58 22.65% 6541.30 5553 10697 6544.09 5705 7647 128070 128070 0.00
 
DPS Timeline Chart
 

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pre_steady_focus.up&(14+cast_regen)<=focus.deficit
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:
  • description:Deals $sw2 Nature damage and generates {$91954s1=14} Focus. Usable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.76
 
dire_beast 0 (1223) 0.0% (6.9%) 10.3 30.70sec 35665 35506

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.30 10.30 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 35505.69 35505.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:
  • description:Summons a powerful wild beast to attack your target for {$d=15 seconds}. Each time the beast deals damage, you will gain {$120694s1=2} Focus.
 
    dire_beast_melee (dire_beast_1) 2573 6.9% 96.8 3.09sec 3793 2471 Direct 96.8 2893 5786 3549 22.7% 22.1 867 1736 22.8%  

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.84 96.84 0.00 0.00 1.5347 0.0000 367270.83 564437.27 34.93 2471.17 2471.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.05 22.79% 1735.52 1348 2710 1724.10 0 2644 8761 13464 34.70
multistrike 17.10 77.21% 867.46 674 1355 867.54 700 1055 14831 22793 34.93
hit 74.88 77.32% 2892.72 2247 4517 2892.80 2528 3160 216607 332891 34.93
crit 21.96 22.68% 5786.21 4495 9034 5785.93 4842 6843 127071 195288 34.93
 
DPS Timeline Chart
 

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
glaive_toss 0 (868) 0.0% (4.9%) 19.0 16.06sec 13713 13652

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.03 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 13651.54 13651.54
 
DPS Timeline Chart
 

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:
  • description:You hurl two glaives toward a target, each dealing {$120761s1=1} damage to each enemy struck and reducing movement speed by {$120761s2=30}% for {$120761d=3 seconds}. The primary target will take {$s1=4} times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
 
    glaive_1 434 2.4% 0.0 0.00sec 0 0 Direct 18.8 5261 10726 6505 22.8% 4.3 1578 3219 22.6%  

Stats details: glaive_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 18.76 0.00 0.00 0.0000 0.0000 130436.03 200459.58 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.97 22.63% 3219.29 2574 5281 2004.70 0 5281 3133 4814 21.74
multistrike 3.33 77.37% 1578.33 1262 2589 1525.73 0 2589 5249 8067 33.76
hit 14.50 77.25% 5261.07 4205 8629 5263.83 4549 6108 76259 117198 34.93
crit 4.27 22.75% 10726.34 8579 17602 10639.55 0 17602 45795 70380 34.63
 
DPS Timeline Chart
 

Action details: glaive_1

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:18.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
    glaive_2 434 2.4% 0.0 0.00sec 0 0 Direct 18.8 5270 10741 6512 22.7% 4.3 1581 3233 22.3%  

Stats details: glaive_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 18.76 0.00 0.00 0.0000 0.0000 130540.51 200620.15 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.96 22.31% 3233.20 2574 5281 1987.21 0 5281 3090 4749 21.47
multistrike 3.33 77.69% 1581.39 1262 2589 1528.14 0 2589 5262 8088 33.73
hit 14.51 77.31% 5270.23 4205 8629 5272.95 4526 6151 76450 117492 34.93
crit 4.26 22.69% 10740.62 8579 17602 10640.95 0 17602 45738 70292 34.59
 
DPS Timeline Chart
 

Action details: glaive_2

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:18.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
kill_command 0 (2550) 0.0% (14.3%) 42.8 7.06sec 17922 17842

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.78 42.78 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 17842.18 17842.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.78 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:6.000
  • base_execute_time:-10.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to instantly inflict $<damage> damage to its target. 25 yard range.
 
    kill_command (cat) 2550 14.3% 42.8 7.06sec 17922 0 Direct 42.8 12639 25273 16775 32.7% 9.8 3791 7577 32.8%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.78 42.78 0.00 0.00 0.0000 0.0000 766660.81 1178236.62 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.20 32.77% 7576.94 5693 13731 7263.80 0 13731 24228 37235 33.49
multistrike 6.56 67.23% 3790.84 2847 6866 3786.53 0 6374 24871 38223 34.87
hit 28.78 67.27% 12639.46 9489 22885 12647.43 11110 14335 363707 558960 34.93
crit 14.00 32.73% 25273.09 18978 45771 25286.12 19594 34777 353854 543818 34.93
 
DPS Timeline Chart
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to instantly inflict $<damage> damage to its target. 25 yard range.}
 
kill_shot 1927 10.8% 19.1 5.75sec 30275 30139 Direct 19.0 23027 47000 28458 22.7% 4.4 6905 14080 22.5%  

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.13 19.04 0.00 0.00 1.0045 0.0000 579007.23 889842.69 34.93 30139.36 30139.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.98 22.49% 14080.29 11222 21615 8874.00 0 21615 13833 21258 22.00
multistrike 3.38 77.51% 6905.00 5501 10595 6691.83 0 10595 23373 35920 33.82
hit 14.73 77.34% 23027.06 18336 35318 23045.78 18605 26996 339080 521113 34.93
crit 4.31 22.66% 47000.02 37406 72049 46608.03 0 72049 202722 311551 34.61
 
DPS Timeline Chart
 

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:80.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus.time_to_max>gcd
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing $sw2 Physical damage. Only usable on enemies with less than 20% health. If the target dies, the Hunter will regain {$164851s1=15}% of maximum health. If Kill Shot fails to kill the target, the cooldown is reset.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.86
 
pet - cat 7196 / 7196
claw 1775 10.0% 98.1 3.09sec 5436 5411 Direct 98.1 3579 7262 5087 41.0% 22.4 1074 2178 40.9%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.09 98.09 0.00 0.00 1.0045 0.0000 533175.67 819406.82 34.93 5411.47 5411.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.18 40.94% 2177.70 1279 6170 2176.82 0 5027 19981 30708 34.92
multistrike 13.24 59.06% 1073.61 640 3085 1074.44 656 2343 14210 21838 34.93
hit 57.92 59.05% 3578.86 2132 10283 3580.51 2820 4705 207282 318560 34.93
crit 40.17 40.95% 7262.10 4264 20567 7268.27 5398 9677 291703 448301 34.93
 
DPS Timeline Chart
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
kill_command 2550 14.3% 42.8 7.06sec 17922 0 Direct 42.8 12639 25273 16775 32.7% 9.8 3791 7577 32.8%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.78 42.78 0.00 0.00 0.0000 0.0000 766660.81 1178236.62 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.20 32.77% 7576.94 5693 13731 7263.80 0 13731 24228 37235 33.49
multistrike 6.56 67.23% 3790.84 2847 6866 3786.53 0 6374 24871 38223 34.87
hit 28.78 67.27% 12639.46 9489 22885 12647.43 11110 14335 363707 558960 34.93
crit 14.00 32.73% 25273.09 18978 45771 25286.12 19594 34777 353854 543818 34.93
 
DPS Timeline Chart
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to instantly inflict $<damage> damage to its target. 25 yard range.}
 
melee 2871 16.1% 231.0 1.30sec 3734 2874 Direct 231.0 2633 5267 3495 32.7% 52.8 790 1580 32.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 231.04 231.04 0.00 0.00 1.2995 0.0000 862750.95 1325911.99 34.93 2873.59 2873.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 17.27 32.71% 1580.17 1196 2885 1580.51 1293 1976 27283 41930 34.93
multistrike 35.51 67.29% 790.03 598 1442 790.29 679 942 28057 43119 34.93
hit 155.47 67.29% 2633.34 1994 4808 2634.21 2414 2848 409417 629210 34.93
crit 75.56 32.71% 5267.08 3987 9616 5268.96 4719 5867 397993 611653 34.93
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - dire_beast_1 2573 / 1223
dire_beast_melee 2573 6.9% 96.8 3.09sec 3793 2471 Direct 96.8 2893 5786 3549 22.7% 22.1 867 1736 22.8%  

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.84 96.84 0.00 0.00 1.5347 0.0000 367270.83 564437.27 34.93 2471.17 2471.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.05 22.79% 1735.52 1348 2710 1724.10 0 2644 8761 13464 34.70
multistrike 17.10 77.21% 867.46 674 1355 867.54 700 1055 14831 22793 34.93
hit 74.88 77.32% 2892.72 2247 4517 2892.80 2528 3160 216607 332891 34.93
crit 21.96 22.68% 5786.21 4495 9034 5785.93 4842 6843 127071 195288 34.93
 
DPS Timeline Chart
 

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Mekkasus
bestial_wrath 5.3 62.70sec

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.26 5.26 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:focus>60&!buff.bestial_wrath.up
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Damage dealt increased by {$?s3044=true}[{$s7=10}%][{$s2=20}%].
  • description:Sends you and your pet into a rage for {$d=10 seconds}. Your pet deals {$s2=20}% additional damage and breaks all loss of control effects. You deal {$s7=10}% more damage and your shots cost {$s6=50}% less Focus.{$?s119410=false}[ Your pet cannot be killed while this effect is active.][ ]
 
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
focus_fire 7.2 38.87sec

Stats details: focus_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.20 7.20 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: focus_fire

Static Values
  • id:82692
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:82692
  • name:Focus Fire
  • school:physical
  • tooltip:Haste increased by $w1%.
  • description:Your pet's Basic Attacks have a {$19623s2=40}% chance to trigger Frenzy, granting {$19623s1=4}% increased attack speed for {$19615d=30 seconds}, stacking up to {$19615u=5} times. Focus Fire consumes all your pet's Frenzy, restoring {$s2=6} Focus to your pet and increasing your haste by {$s1=6}% per Frenzy application consumed. Lasts for {$d=20 seconds}.
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: summon_pet

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
agile 5.5 0.0 59.7sec 59.7sec 35.17% 35.18% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_agile
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:472.00

Stack Uptimes

  • agile_1:35.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:126554
  • name:Agile
  • tooltip:Agility increased by {$s1=522}.
  • description:Agility increased by {$s1=522} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
bestial_wrath 5.3 0.0 62.7sec 62.7sec 17.24% 41.47% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bestial_wrath_1:17.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$?s3044=true}[{$s7=10}%][{$s2=20}%].
  • description:Sends you and your pet into a rage for {$d=10 seconds}. Your pet deals {$s2=20}% additional damage and breaks all loss of control effects. You deal {$s7=10}% more damage and your shots cost {$s6=50}% less Focus.{$?s119410=false}[ Your pet cannot be killed while this effect is active.][ ]
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 12.19% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
cobra_strikes 11.2 0.9 25.3sec 23.2sec 7.16% 12.27% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_cobra_strikes
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • cobra_strikes_1:6.75%
  • cobra_strikes_2:0.39%
  • cobra_strikes_3:0.02%
  • cobra_strikes_4:0.00%

Trigger Attempt Success

  • trigger_pct:19.95%

Spelldata details

  • id:53257
  • name:Cobra Strikes
  • tooltip:Pet's critical strike chance with Basic Attacks increased by 100%.
  • description:{$@spelldesc53260=Your successful Arcane Shots have a {$h=20}% chance to grant you a charge of Cobra Strikes. Each charge causes 1 of your pet's Basic Attacks to critically hit. Max 6 charges.}
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
draenic_agility_potion 2.0 0.0 260.2sec 0.0sec 15.01% 15.03% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
exquisite_proficiency 4.8 0.0 69.5sec 69.5sec 30.76% 30.77% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_exquisite_proficiency
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:mastery_rating
  • amount:546.00

Stack Uptimes

  • exquisite_proficiency_1:30.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:133630
  • name:Exquisite Proficiency
  • tooltip:Increases Mastery rating by {$s1=609}.
  • description:Increases Mastery rating by {$s1=609} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
focus_fire 6.7 0.5 41.9sec 38.9sec 45.70% 48.93% 0.5(0.5)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_focus_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • focus_fire_1:45.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:82692
  • name:Focus Fire
  • tooltip:Haste increased by $w1%.
  • description:Your pet's Basic Attacks have a {$19623s2=40}% chance to trigger Frenzy, granting {$19623s1=4}% increased attack speed for {$19615d=30 seconds}, stacking up to {$19615u=5} times. Focus Fire consumes all your pet's Frenzy, restoring {$s2=6} Focus to your pet and increasing your haste by {$s1=6}% per Frenzy application consumed. Lasts for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
lord_blastingtons_scope_of_doom 9.8 7.0 30.1sec 17.0sec 42.53% 42.54% 7.0(7.0)

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:112.00

Stack Uptimes

  • lord_blastingtons_scope_of_doom_1:42.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by {$s1=112}.
  • description:Increases agility by {$s1=112}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
(cat-) cat-bestial_wrath 5.3 0.0 62.7sec 62.7sec 17.24% 17.73% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bestial_wrath_1:17.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$?s3044=false}[{$s7=10}%][{$s2=20}%].
  • description:Sends you and your pet into a rage for {$d=10 seconds}. Your pet deals {$s2=20}% additional damage and breaks all loss of control effects. You deal {$s7=10}% more damage and your shots cost {$s6=50}% less Focus.{$?s119410=false}[ Your pet cannot be killed while this effect is active.][ ]
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
(cat-) cat-enhanced_basic_attacks 14.7 0.0 19.2sec 19.2sec 10.59% 14.80% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus_cat
  • cooldown name:buff_enhanced_basic_attacks
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enhanced_basic_attacks_1:10.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157715
  • name:Enhanced Basic Attacks
  • tooltip:
  • description:Your pet's basic attacks have a {$s1=15}% chance to reset the basic attack cooldown and make the next basic attack free.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
(cat-) cat-frenzy 8.4 30.8 37.0sec 7.6sec 82.80% 82.73% 0.0(0.0)

Buff details

  • buff initial source:Mekkasus_cat
  • cooldown name:buff_frenzy
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:0.00

Stack Uptimes

  • frenzy_1:20.39%
  • frenzy_2:20.39%
  • frenzy_3:20.24%
  • frenzy_4:20.00%
  • frenzy_5:1.78%

Trigger Attempt Success

  • trigger_pct:39.93%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by {$s1=4}%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for {$19615d=30 seconds} and stacking up to {$19615u=5} times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Mekkasus
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mekkasus
a_murder_of_crows Focus 5.4 108.5 20.2 20.2 5564.0
arcane_shot Focus 60.8 1400.5 23.1 23.1 339.4
glaive_toss Focus 19.0 253.1 13.3 13.3 1030.9
kill_command Focus 42.8 1518.3 35.5 35.5 504.9
pet - cat
claw Focus 83.5 2703.2 32.4 27.6 197.2
Resource Gains Type Count Total Average Overflow
focus_regen Focus 256.84 1540.53 (47.74%) 6.00 17.13 1.10%
invigoration Focus 14.73 289.40 (8.97%) 19.65 5.22 1.77%
cobra_shot Focus 86.43 1205.47 (37.36%) 13.95 4.51 0.37%
dire_beast Focus 96.84 191.22 (5.93%) 1.97 2.47 1.27%
pet - cat
focus_regen Focus 300.34 1947.08 (74.70%) 6.48 0.33 0.02%
focus_fire Focus 7.20 216.02 (8.29%) 30.00 0.00 0.00%
go_for_the_throat Focus 29.56 443.37 (17.01%) 15.00 0.05 0.01%
Resource RPS-Gain RPS-Loss
Focus 10.72 10.90
Combat End Resource Mean Min Max
Focus 46.19 0.02 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.5%
cat-Focus Cap 0.5%
devilsaur-Focus Cap 0.5%
raptor-Focus Cap 0.5%
hyena-Focus Cap 0.5%
wolf-Focus Cap 0.5%
wasp-Focus Cap 0.5%
t17_pet_2-Focus Cap 0.5%
t17_pet_1-Focus Cap 0.5%
dire_beast_1-Focus Cap 0.5%
dire_beast_2-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%
tier15_thunderhawk-Focus Cap 0.5%

Procs

Count Interval
starved: a_murder_of_crows 0.2 14.4sec
invigoration 14.7 19.3sec

Statistics & Data Analysis

Fight Length
Sample Data Mekkasus Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Mekkasus Damage Per Second
Count 25000
Mean 17780.18
Minimum 15284.42
Maximum 20612.71
Spread ( max - min ) 5328.29
Range [ ( max - min ) / 2 * 100% ] 14.98%
Standard Deviation 660.3758
5th Percentile 16695.97
95th Percentile 18864.49
( 95th Percentile - 5th Percentile ) 2168.53
Mean Distribution
Standard Deviation 4.1766
95.00% Confidence Intervall ( 17771.99 - 17788.36 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5299
0.1 Scale Factor Error with Delta=300 3722
0.05 Scale Factor Error with Delta=300 14891
0.01 Scale Factor Error with Delta=300 372276
Distribution Chart
DPS(e)
Sample Data Mekkasus Damage Per Second (Effective)
Count 25000
Mean 17780.18
Minimum 15284.42
Maximum 20612.71
Spread ( max - min ) 5328.29
Range [ ( max - min ) / 2 * 100% ] 14.98%
Damage
Sample Data Mekkasus Damage
Count 25000
Mean 2812833.01
Minimum 2006805.78
Maximum 3663199.53
Spread ( max - min ) 1656393.75
Range [ ( max - min ) / 2 * 100% ] 29.44%
DTPS
Sample Data Mekkasus Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mekkasus Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Mekkasus Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mekkasus Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mekkasus Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mekkasus Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data MekkasusTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Mekkasus Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 exotic_munitions,ammo_type=poisoned,if=active_enemies<3
5 0.00 exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
6 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
8 0.00 arcane_torrent,if=focus.deficit>=30
9 0.00 blood_fury
A 0.00 berserking
B 0.75 potion,name=draenic_agility,if=!talent.stampede.enabled&buff.bestial_wrath.up&target.health.pct<=20|target.time_to_die<=20
C 0.25 potion,name=draenic_agility,if=talent.stampede.enabled&cooldown.stampede.remains<1&(buff.bloodlust.up|buff.focus_fire.up)|target.time_to_die<=25
D 0.00 stampede,if=buff.bloodlust.up|buff.focus_fire.up|target.time_to_die<=25
E 10.30 dire_beast
F 0.00 explosive_trap,if=active_enemies>1
G 5.26 bestial_wrath,if=focus>60&!buff.bestial_wrath.up
H 0.00 barrage,if=active_enemies>1
I 0.00 multishot,if=active_enemies>5|(active_enemies>1&pet.cat.buff.beast_cleave.down)
J 7.20 focus_fire,five_stacks=1
K 0.00 barrage,if=active_enemies>1
L 5.38 a_murder_of_crows
M 19.13 kill_shot,if=focus.time_to_max>gcd
N 42.78 kill_command
O 0.00 focusing_shot,if=focus<50
P 0.00 cobra_shot,if=buff.pre_steady_focus.up&(14+cast_regen)<=focus.deficit
Cast a second shot for steady focus if that won't cap us.
Q 19.03 glaive_toss
R 0.00 barrage
S 0.00 powershot,if=focus.time_to_max>cast_time
T 0.00 cobra_shot,if=active_enemies>5
U 28.13 arcane_shot,if=(buff.thrill_of_the_hunt.react&focus>35)|buff.bestial_wrath.up
V 32.62 arcane_shot,if=focus>=64
W 87.05 cobra_shot

Sample Sequence

01267EGLNQUUUUNUUWWWNVWQVWNWWWVNWEVWQNWWWVNJVWVWNQWWVWNVWVWEGLNQUUUUNWUWWNWQVWNWWVVNWEJQWNWWVVWNWWVWNQWWVNWWVGLENUUJQUNWWWVNWWVVWNQWWVWNVEWWJNQWVWVNWWWVNWWQVWNWJGLEUMMNUUQUWWNWMMVWNWWQVMMNWEWWNWMMQVNWWWNMMVWWJNQWEGBLMMNUUUUUNWWMMQNWVWWNMMVWENQJWWMMNVWWVVN

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 100.0/100: 100% focus
Pre food Fluffy_Pillow 100.0/100: 100% focus
Pre summon_pet Fluffy_Pillow 100.0/100: 100% focus
Pre potion Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 start_auto_shot Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 dire_beast Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:01.006 bestial_wrath Fluffy_Pillow 100.0/100: 100% focus bloodlust, draenic_agility_potion
0:01.006 a_murder_of_crows Fluffy_Pillow 100.0/100: 100% focus bloodlust, bestial_wrath, draenic_agility_potion
0:02.011 kill_command Fluffy_Pillow 92.7/100: 93% focus bloodlust, bestial_wrath, draenic_agility_potion
0:03.014 glaive_toss Fluffy_Pillow 78.5/100: 78% focus bloodlust, bestial_wrath, draenic_agility_potion
0:04.018 arcane_shot Fluffy_Pillow 78.7/100: 79% focus bloodlust, bestial_wrath, exquisite_proficiency, draenic_agility_potion
0:05.022 arcane_shot Fluffy_Pillow 71.4/100: 71% focus bloodlust, bestial_wrath, exquisite_proficiency, agile, draenic_agility_potion
0:06.028 arcane_shot Fluffy_Pillow 64.2/100: 64% focus bloodlust, bestial_wrath, cobra_strikes, exquisite_proficiency, agile, draenic_agility_potion
0:07.032 arcane_shot Fluffy_Pillow 54.9/100: 55% focus bloodlust, bestial_wrath, cobra_strikes, exquisite_proficiency, agile, draenic_agility_potion
0:08.036 kill_command Fluffy_Pillow 47.7/100: 48% focus bloodlust, bestial_wrath, cobra_strikes, exquisite_proficiency, agile, draenic_agility_potion
0:09.040 arcane_shot Fluffy_Pillow 35.4/100: 35% focus bloodlust, bestial_wrath, exquisite_proficiency, agile, draenic_agility_potion
0:10.043 arcane_shot Fluffy_Pillow 26.1/100: 26% focus bloodlust, bestial_wrath, exquisite_proficiency, agile, draenic_agility_potion
0:11.047 cobra_shot Fluffy_Pillow 18.9/100: 19% focus bloodlust, cobra_strikes, exquisite_proficiency, agile, draenic_agility_potion
0:12.453 cobra_shot Fluffy_Pillow 28.9/100: 29% focus bloodlust, exquisite_proficiency, agile, draenic_agility_potion
0:13.857 cobra_shot Fluffy_Pillow 52.9/100: 53% focus bloodlust, exquisite_proficiency, agile, draenic_agility_potion
0:15.261 kill_command Fluffy_Pillow 76.9/100: 77% focus bloodlust, exquisite_proficiency, agile, draenic_agility_potion
0:16.264 arcane_shot Fluffy_Pillow 76.7/100: 77% focus bloodlust, exquisite_proficiency, agile, draenic_agility_potion
0:17.268 cobra_shot Fluffy_Pillow 52.4/100: 52% focus bloodlust, exquisite_proficiency, agile, draenic_agility_potion
0:18.672 glaive_toss Fluffy_Pillow 60.4/100: 60% focus bloodlust, exquisite_proficiency, agile, draenic_agility_potion
0:19.676 arcane_shot Fluffy_Pillow 65.2/100: 65% focus bloodlust, exquisite_proficiency, agile, draenic_agility_potion
0:20.681 cobra_shot Fluffy_Pillow 40.9/100: 41% focus bloodlust, exquisite_proficiency, agile
0:22.085 kill_command Fluffy_Pillow 48.9/100: 49% focus bloodlust, exquisite_proficiency, agile
0:23.089 cobra_shot Fluffy_Pillow 28.7/100: 29% focus bloodlust, exquisite_proficiency, agile
0:24.495 cobra_shot Fluffy_Pillow 36.7/100: 37% focus bloodlust, agile
0:25.899 cobra_shot Fluffy_Pillow 58.7/100: 59% focus bloodlust
0:27.302 arcane_shot Fluffy_Pillow 80.7/100: 81% focus bloodlust
0:28.307 kill_command Fluffy_Pillow 70.5/100: 70% focus bloodlust
0:29.312 cobra_shot Fluffy_Pillow 36.2/100: 36% focus bloodlust
0:30.717 dire_beast Fluffy_Pillow 44.2/100: 44% focus bloodlust
0:31.722 arcane_shot Fluffy_Pillow 66.0/100: 66% focus bloodlust
0:32.727 cobra_shot Fluffy_Pillow 43.7/100: 44% focus bloodlust
0:34.131 glaive_toss Fluffy_Pillow 53.7/100: 54% focus bloodlust
0:35.137 kill_command Fluffy_Pillow 60.5/100: 60% focus bloodlust
0:36.140 cobra_shot Fluffy_Pillow 26.2/100: 26% focus bloodlust
0:37.545 cobra_shot Fluffy_Pillow 36.2/100: 36% focus bloodlust
0:38.950 cobra_shot Fluffy_Pillow 60.3/100: 60% focus bloodlust
0:40.353 arcane_shot Fluffy_Pillow 84.3/100: 84% focus bloodlust
0:41.359 kill_command Fluffy_Pillow 74.7/100: 75% focus
0:42.364 focus_fire Fluffy_Pillow 61.1/100: 61% focus
0:43.367 arcane_shot Fluffy_Pillow 66.8/100: 67% focus focus_fire
0:44.371 cobra_shot Fluffy_Pillow 44.6/100: 45% focus focus_fire
0:45.776 arcane_shot Fluffy_Pillow 72.6/100: 73% focus focus_fire
0:46.781 cobra_shot Fluffy_Pillow 62.4/100: 62% focus focus_fire
0:48.186 kill_command Fluffy_Pillow 70.4/100: 70% focus focus_fire
0:49.192 glaive_toss Fluffy_Pillow 50.1/100: 50% focus focus_fire
0:50.195 cobra_shot Fluffy_Pillow 40.9/100: 41% focus focus_fire
0:51.599 cobra_shot Fluffy_Pillow 48.9/100: 49% focus focus_fire
0:53.002 arcane_shot Fluffy_Pillow 70.9/100: 71% focus focus_fire
0:54.007 cobra_shot Fluffy_Pillow 60.6/100: 61% focus cobra_strikes, focus_fire, lord_blastingtons_scope_of_doom
0:55.411 kill_command Fluffy_Pillow 88.7/100: 89% focus focus_fire, lord_blastingtons_scope_of_doom
0:56.415 arcane_shot Fluffy_Pillow 68.4/100: 68% focus focus_fire, lord_blastingtons_scope_of_doom
0:57.421 cobra_shot Fluffy_Pillow 44.1/100: 44% focus focus_fire, lord_blastingtons_scope_of_doom
0:58.826 arcane_shot Fluffy_Pillow 72.2/100: 72% focus focus_fire, lord_blastingtons_scope_of_doom
0:59.832 cobra_shot Fluffy_Pillow 61.9/100: 62% focus focus_fire, lord_blastingtons_scope_of_doom
1:01.238 dire_beast Fluffy_Pillow 69.9/100: 70% focus focus_fire, lord_blastingtons_scope_of_doom
1:02.244 bestial_wrath Fluffy_Pillow 91.7/100: 92% focus focus_fire, lord_blastingtons_scope_of_doom
1:02.244 a_murder_of_crows Fluffy_Pillow 91.7/100: 92% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom
1:03.248 kill_command Fluffy_Pillow 83.3/100: 83% focus bestial_wrath, agile, lord_blastingtons_scope_of_doom
1:04.253 glaive_toss Fluffy_Pillow 67.7/100: 68% focus bestial_wrath, agile
1:05.258 arcane_shot Fluffy_Pillow 66.6/100: 67% focus bestial_wrath, agile
1:06.262 arcane_shot Fluffy_Pillow 56.0/100: 56% focus bestial_wrath, agile
1:07.267 arcane_shot Fluffy_Pillow 47.4/100: 47% focus bestial_wrath, agile
1:08.271 arcane_shot Fluffy_Pillow 38.8/100: 39% focus bestial_wrath, agile
1:09.277 kill_command Fluffy_Pillow 28.3/100: 28% focus bestial_wrath, agile
1:10.281 cobra_shot Fluffy_Pillow 14.7/100: 15% focus bestial_wrath, agile
1:12.105 arcane_shot Fluffy_Pillow 24.7/100: 25% focus bestial_wrath, agile
1:13.109 cobra_shot Fluffy_Pillow 28.1/100: 28% focus agile
1:14.933 cobra_shot Fluffy_Pillow 38.1/100: 38% focus agile
1:16.755 kill_command Fluffy_Pillow 62.1/100: 62% focus agile
1:17.761 cobra_shot Fluffy_Pillow 40.5/100: 41% focus agile
1:19.587 glaive_toss Fluffy_Pillow 68.6/100: 69% focus agile
1:20.592 arcane_shot Fluffy_Pillow 72.0/100: 72% focus agile
1:21.597 cobra_shot Fluffy_Pillow 46.4/100: 46% focus agile
1:23.422 kill_command Fluffy_Pillow 54.4/100: 54% focus exquisite_proficiency
1:24.427 cobra_shot Fluffy_Pillow 32.8/100: 33% focus exquisite_proficiency
1:26.252 cobra_shot Fluffy_Pillow 60.8/100: 61% focus exquisite_proficiency
1:28.076 arcane_shot Fluffy_Pillow 100.0/100: 100% focus exquisite_proficiency
1:29.081 arcane_shot Fluffy_Pillow 88.4/100: 88% focus exquisite_proficiency
1:30.086 kill_command Fluffy_Pillow 62.8/100: 63% focus exquisite_proficiency
1:31.089 cobra_shot Fluffy_Pillow 27.2/100: 27% focus exquisite_proficiency
1:32.914 dire_beast Fluffy_Pillow 35.3/100: 35% focus exquisite_proficiency
1:33.918 focus_fire Fluffy_Pillow 55.7/100: 56% focus exquisite_proficiency
1:34.923 glaive_toss Fluffy_Pillow 63.4/100: 63% focus focus_fire, exquisite_proficiency
1:35.927 cobra_shot Fluffy_Pillow 54.1/100: 54% focus focus_fire, exquisite_proficiency
1:37.332 kill_command Fluffy_Pillow 64.2/100: 64% focus focus_fire, exquisite_proficiency
1:38.337 cobra_shot Fluffy_Pillow 45.9/100: 46% focus focus_fire, exquisite_proficiency
1:39.742 cobra_shot Fluffy_Pillow 55.9/100: 56% focus focus_fire, exquisite_proficiency
1:41.145 arcane_shot Fluffy_Pillow 80.0/100: 80% focus focus_fire, exquisite_proficiency
1:42.150 arcane_shot Fluffy_Pillow 71.7/100: 72% focus focus_fire
1:43.153 cobra_shot Fluffy_Pillow 49.4/100: 49% focus cobra_strikes, focus_fire
1:44.557 kill_command Fluffy_Pillow 59.5/100: 59% focus cobra_strikes, focus_fire
1:45.561 cobra_shot Fluffy_Pillow 39.2/100: 39% focus cobra_strikes, focus_fire
1:46.966 cobra_shot Fluffy_Pillow 49.2/100: 49% focus focus_fire
1:48.370 arcane_shot Fluffy_Pillow 73.2/100: 73% focus focus_fire
1:49.374 cobra_shot Fluffy_Pillow 63.0/100: 63% focus focus_fire
1:50.777 kill_command Fluffy_Pillow 71.0/100: 71% focus focus_fire
1:51.782 glaive_toss Fluffy_Pillow 50.7/100: 51% focus focus_fire
1:52.787 cobra_shot Fluffy_Pillow 41.5/100: 41% focus focus_fire
1:54.190 cobra_shot Fluffy_Pillow 49.1/100: 49% focus
1:56.015 arcane_shot Fluffy_Pillow 71.1/100: 71% focus
1:57.019 kill_command Fluffy_Pillow 79.6/100: 80% focus
1:58.023 cobra_shot Fluffy_Pillow 44.0/100: 44% focus
1:59.847 cobra_shot Fluffy_Pillow 52.0/100: 52% focus
2:01.672 arcane_shot Fluffy_Pillow 74.0/100: 74% focus
2:02.677 bestial_wrath Fluffy_Pillow 62.4/100: 62% focus
2:02.677 a_murder_of_crows Fluffy_Pillow 62.4/100: 62% focus bestial_wrath
2:03.680 dire_beast Fluffy_Pillow 51.8/100: 52% focus bestial_wrath, agile
2:04.686 kill_command Fluffy_Pillow 58.2/100: 58% focus bestial_wrath, agile
2:05.692 arcane_shot Fluffy_Pillow 44.7/100: 45% focus bestial_wrath, agile
2:06.696 arcane_shot Fluffy_Pillow 34.1/100: 34% focus bestial_wrath, agile
2:07.700 focus_fire Fluffy_Pillow 25.5/100: 25% focus bestial_wrath, agile
2:08.703 glaive_toss Fluffy_Pillow 31.2/100: 31% focus bestial_wrath, focus_fire, agile
2:09.707 arcane_shot Fluffy_Pillow 31.5/100: 31% focus bestial_wrath, focus_fire, agile
2:10.712 kill_command Fluffy_Pillow 24.2/100: 24% focus bestial_wrath, focus_fire, agile, lord_blastingtons_scope_of_doom
2:11.719 cobra_shot Fluffy_Pillow 10.0/100: 10% focus bestial_wrath, focus_fire, agile, lord_blastingtons_scope_of_doom
2:13.123 cobra_shot Fluffy_Pillow 20.0/100: 20% focus focus_fire, agile, lord_blastingtons_scope_of_doom
2:14.528 cobra_shot Fluffy_Pillow 44.0/100: 44% focus focus_fire, agile, lord_blastingtons_scope_of_doom
2:15.933 arcane_shot Fluffy_Pillow 88.0/100: 88% focus focus_fire, agile, lord_blastingtons_scope_of_doom
2:16.937 kill_command Fluffy_Pillow 79.8/100: 80% focus focus_fire, agile, lord_blastingtons_scope_of_doom
2:17.942 cobra_shot Fluffy_Pillow 47.5/100: 48% focus focus_fire, agile, lord_blastingtons_scope_of_doom
2:19.346 cobra_shot Fluffy_Pillow 55.5/100: 56% focus focus_fire, agile, lord_blastingtons_scope_of_doom
2:20.752 arcane_shot Fluffy_Pillow 77.6/100: 78% focus focus_fire, agile
2:21.758 arcane_shot Fluffy_Pillow 67.3/100: 67% focus focus_fire, agile
2:22.762 cobra_shot Fluffy_Pillow 43.0/100: 43% focus focus_fire, agile
2:24.166 kill_command Fluffy_Pillow 71.1/100: 71% focus focus_fire
2:25.172 glaive_toss Fluffy_Pillow 50.8/100: 51% focus focus_fire
2:26.176 cobra_shot Fluffy_Pillow 41.5/100: 42% focus focus_fire
2:27.581 cobra_shot Fluffy_Pillow 49.6/100: 50% focus focus_fire, exquisite_proficiency
2:28.986 arcane_shot Fluffy_Pillow 69.9/100: 70% focus exquisite_proficiency
2:29.992 cobra_shot Fluffy_Pillow 58.3/100: 58% focus exquisite_proficiency
2:31.814 kill_command Fluffy_Pillow 86.3/100: 86% focus exquisite_proficiency
2:32.816 arcane_shot Fluffy_Pillow 64.7/100: 65% focus exquisite_proficiency
2:33.823 dire_beast Fluffy_Pillow 39.2/100: 39% focus exquisite_proficiency
2:34.829 cobra_shot Fluffy_Pillow 45.6/100: 46% focus exquisite_proficiency
2:36.652 cobra_shot Fluffy_Pillow 55.6/100: 56% focus exquisite_proficiency
2:38.477 focus_fire Fluffy_Pillow 79.6/100: 80% focus exquisite_proficiency
2:39.482 kill_command Fluffy_Pillow 100.0/100: 100% focus focus_fire, exquisite_proficiency
2:40.487 glaive_toss Fluffy_Pillow 65.7/100: 66% focus focus_fire, exquisite_proficiency
2:41.493 cobra_shot Fluffy_Pillow 58.5/100: 58% focus focus_fire, exquisite_proficiency
2:42.899 arcane_shot Fluffy_Pillow 68.5/100: 69% focus focus_fire, exquisite_proficiency
2:43.903 cobra_shot Fluffy_Pillow 60.3/100: 60% focus focus_fire, exquisite_proficiency
2:45.308 arcane_shot Fluffy_Pillow 70.3/100: 70% focus focus_fire, exquisite_proficiency
2:46.312 kill_command Fluffy_Pillow 62.0/100: 62% focus focus_fire, exquisite_proficiency
2:47.317 cobra_shot Fluffy_Pillow 27.8/100: 28% focus focus_fire, exquisite_proficiency
2:48.721 cobra_shot Fluffy_Pillow 37.8/100: 38% focus focus_fire
2:50.125 cobra_shot Fluffy_Pillow 59.8/100: 60% focus focus_fire, lord_blastingtons_scope_of_doom
2:51.527 arcane_shot Fluffy_Pillow 81.8/100: 82% focus focus_fire, lord_blastingtons_scope_of_doom
2:52.532 kill_command Fluffy_Pillow 71.6/100: 72% focus focus_fire, lord_blastingtons_scope_of_doom
2:53.538 cobra_shot Fluffy_Pillow 37.3/100: 37% focus focus_fire, lord_blastingtons_scope_of_doom
2:54.941 cobra_shot Fluffy_Pillow 45.3/100: 45% focus focus_fire, lord_blastingtons_scope_of_doom
2:56.347 glaive_toss Fluffy_Pillow 67.3/100: 67% focus focus_fire, lord_blastingtons_scope_of_doom
2:57.353 arcane_shot Fluffy_Pillow 72.1/100: 72% focus focus_fire, lord_blastingtons_scope_of_doom
2:58.357 cobra_shot Fluffy_Pillow 47.8/100: 48% focus focus_fire, lord_blastingtons_scope_of_doom
2:59.762 kill_command Fluffy_Pillow 54.2/100: 54% focus
3:00.766 cobra_shot Fluffy_Pillow 32.6/100: 33% focus
3:02.591 focus_fire Fluffy_Pillow 40.6/100: 41% focus
3:03.597 bestial_wrath Fluffy_Pillow 60.3/100: 60% focus focus_fire
3:03.597 a_murder_of_crows Fluffy_Pillow 60.3/100: 60% focus bestial_wrath, focus_fire
3:04.601 dire_beast Fluffy_Pillow 51.1/100: 51% focus bestial_wrath, focus_fire
3:05.606 arcane_shot Fluffy_Pillow 58.8/100: 59% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom
3:06.612 kill_shot Fluffy_Pillow 51.6/100: 52% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom
3:07.617 kill_shot Fluffy_Pillow 59.3/100: 59% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom
3:08.622 kill_command Fluffy_Pillow 65.0/100: 65% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom
3:09.627 arcane_shot Fluffy_Pillow 52.8/100: 53% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom
3:10.630 arcane_shot Fluffy_Pillow 45.5/100: 46% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom
3:11.636 glaive_toss Fluffy_Pillow 38.3/100: 38% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom
3:12.641 arcane_shot Fluffy_Pillow 36.5/100: 37% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom
3:13.645 cobra_shot Fluffy_Pillow 29.2/100: 29% focus focus_fire, agile, lord_blastingtons_scope_of_doom
3:15.051 cobra_shot Fluffy_Pillow 39.3/100: 39% focus focus_fire, agile, lord_blastingtons_scope_of_doom
3:16.456 kill_command Fluffy_Pillow 63.3/100: 63% focus focus_fire, agile
3:17.461 cobra_shot Fluffy_Pillow 45.0/100: 45% focus focus_fire, agile
3:18.867 kill_shot Fluffy_Pillow 53.1/100: 53% focus focus_fire, agile
3:19.872 kill_shot Fluffy_Pillow 72.8/100: 73% focus focus_fire, agile
3:20.876 arcane_shot Fluffy_Pillow 78.6/100: 79% focus focus_fire, agile, lord_blastingtons_scope_of_doom
3:21.879 cobra_shot Fluffy_Pillow 54.3/100: 54% focus focus_fire, agile, lord_blastingtons_scope_of_doom
3:23.283 kill_command Fluffy_Pillow 61.4/100: 61% focus agile, lord_blastingtons_scope_of_doom
3:24.287 cobra_shot Fluffy_Pillow 39.8/100: 40% focus agile, lord_blastingtons_scope_of_doom
3:26.111 cobra_shot Fluffy_Pillow 47.8/100: 48% focus agile, lord_blastingtons_scope_of_doom
3:27.936 glaive_toss Fluffy_Pillow 69.8/100: 70% focus agile, lord_blastingtons_scope_of_doom
3:28.940 arcane_shot Fluffy_Pillow 73.2/100: 73% focus agile, lord_blastingtons_scope_of_doom
3:29.944 kill_shot Fluffy_Pillow 47.7/100: 48% focus agile
3:30.950 kill_shot Fluffy_Pillow 52.1/100: 52% focus agile
3:31.954 kill_command Fluffy_Pillow 56.5/100: 56% focus agile
3:32.958 cobra_shot Fluffy_Pillow 20.9/100: 21% focus agile
3:34.785 dire_beast Fluffy_Pillow 28.9/100: 29% focus
3:35.792 cobra_shot Fluffy_Pillow 49.4/100: 49% focus
3:37.617 cobra_shot Fluffy_Pillow 59.4/100: 59% focus
3:39.443 kill_command Fluffy_Pillow 83.4/100: 83% focus exquisite_proficiency
3:40.447 cobra_shot Fluffy_Pillow 63.8/100: 64% focus exquisite_proficiency
3:42.270 kill_shot Fluffy_Pillow 73.8/100: 74% focus exquisite_proficiency
3:43.275 kill_shot Fluffy_Pillow 92.2/100: 92% focus exquisite_proficiency
3:44.280 glaive_toss Fluffy_Pillow 100.0/100: 100% focus exquisite_proficiency
3:45.284 arcane_shot Fluffy_Pillow 89.4/100: 89% focus exquisite_proficiency
3:46.289 kill_command Fluffy_Pillow 65.8/100: 66% focus cobra_strikes, exquisite_proficiency, lord_blastingtons_scope_of_doom
3:47.292 cobra_shot Fluffy_Pillow 30.2/100: 30% focus exquisite_proficiency, lord_blastingtons_scope_of_doom
3:49.117 cobra_shot Fluffy_Pillow 40.3/100: 40% focus exquisite_proficiency, lord_blastingtons_scope_of_doom
3:50.941 cobra_shot Fluffy_Pillow 62.3/100: 62% focus exquisite_proficiency, lord_blastingtons_scope_of_doom
3:52.765 kill_command Fluffy_Pillow 84.3/100: 84% focus exquisite_proficiency, lord_blastingtons_scope_of_doom
3:53.768 kill_shot Fluffy_Pillow 62.7/100: 63% focus exquisite_proficiency, lord_blastingtons_scope_of_doom
3:54.772 kill_shot Fluffy_Pillow 67.1/100: 67% focus exquisite_proficiency, lord_blastingtons_scope_of_doom
3:55.777 arcane_shot Fluffy_Pillow 71.5/100: 72% focus exquisite_proficiency
3:56.781 cobra_shot Fluffy_Pillow 45.9/100: 46% focus exquisite_proficiency
3:58.606 cobra_shot Fluffy_Pillow 54.0/100: 54% focus exquisite_proficiency, lord_blastingtons_scope_of_doom
4:00.430 focus_fire Fluffy_Pillow 76.0/100: 76% focus lord_blastingtons_scope_of_doom
4:01.434 kill_command Fluffy_Pillow 95.7/100: 96% focus focus_fire, lord_blastingtons_scope_of_doom
4:02.439 glaive_toss Fluffy_Pillow 61.4/100: 61% focus focus_fire, lord_blastingtons_scope_of_doom
4:03.442 cobra_shot Fluffy_Pillow 52.2/100: 52% focus focus_fire, lord_blastingtons_scope_of_doom
4:04.847 dire_beast Fluffy_Pillow 60.2/100: 60% focus focus_fire, lord_blastingtons_scope_of_doom
4:05.852 bestial_wrath Fluffy_Pillow 81.9/100: 82% focus focus_fire, lord_blastingtons_scope_of_doom
4:05.852 potion Fluffy_Pillow 81.9/100: 82% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom
4:05.852 a_murder_of_crows Fluffy_Pillow 81.9/100: 82% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:06.856 kill_shot Fluffy_Pillow 74.7/100: 75% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:07.861 kill_shot Fluffy_Pillow 82.4/100: 82% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:08.867 kill_command Fluffy_Pillow 88.2/100: 88% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:09.873 arcane_shot Fluffy_Pillow 75.9/100: 76% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:10.878 arcane_shot Fluffy_Pillow 68.7/100: 69% focus bestial_wrath, focus_fire, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:11.881 arcane_shot Fluffy_Pillow 61.4/100: 61% focus bestial_wrath, cobra_strikes, focus_fire, lord_blastingtons_scope_of_doom, draenic_agility_potion
4:12.886 arcane_shot Fluffy_Pillow 52.1/100: 52% focus bestial_wrath, cobra_strikes, focus_fire, draenic_agility_potion
4:13.891 arcane_shot Fluffy_Pillow 44.9/100: 45% focus bestial_wrath, focus_fire, agile, draenic_agility_potion
4:14.898 kill_command Fluffy_Pillow 37.6/100: 38% focus bestial_wrath, focus_fire, agile, draenic_agility_potion
4:15.904 cobra_shot Fluffy_Pillow 23.4/100: 23% focus focus_fire, agile, draenic_agility_potion
4:17.308 cobra_shot Fluffy_Pillow 33.4/100: 33% focus focus_fire, agile, draenic_agility_potion
4:18.714 kill_shot Fluffy_Pillow 57.4/100: 57% focus focus_fire, agile, draenic_agility_potion
4:19.717 kill_shot Fluffy_Pillow 77.2/100: 77% focus focus_fire, agile, draenic_agility_potion
4:20.721 glaive_toss Fluffy_Pillow 82.5/100: 83% focus agile, draenic_agility_potion
4:21.724 kill_command Fluffy_Pillow 71.9/100: 72% focus agile, draenic_agility_potion
4:22.729 cobra_shot Fluffy_Pillow 56.3/100: 56% focus agile, draenic_agility_potion
4:24.554 arcane_shot Fluffy_Pillow 64.3/100: 64% focus agile, draenic_agility_potion
4:25.560 cobra_shot Fluffy_Pillow 52.8/100: 53% focus agile, draenic_agility_potion
4:27.383 cobra_shot Fluffy_Pillow 60.8/100: 61% focus agile, draenic_agility_potion
4:29.207 kill_command Fluffy_Pillow 82.8/100: 83% focus agile, draenic_agility_potion
4:30.212 kill_shot Fluffy_Pillow 61.2/100: 61% focus agile, draenic_agility_potion
4:31.216 kill_shot Fluffy_Pillow 65.6/100: 66% focus agile
4:32.220 arcane_shot Fluffy_Pillow 70.0/100: 70% focus agile
4:33.224 cobra_shot Fluffy_Pillow 44.4/100: 44% focus lord_blastingtons_scope_of_doom
4:35.050 dire_beast Fluffy_Pillow 52.5/100: 52% focus lord_blastingtons_scope_of_doom
4:36.055 kill_command Fluffy_Pillow 72.9/100: 73% focus lord_blastingtons_scope_of_doom
4:37.060 glaive_toss Fluffy_Pillow 39.3/100: 39% focus lord_blastingtons_scope_of_doom
4:38.063 focus_fire Fluffy_Pillow 28.7/100: 29% focus lord_blastingtons_scope_of_doom
4:39.067 cobra_shot Fluffy_Pillow 36.4/100: 36% focus focus_fire, lord_blastingtons_scope_of_doom
4:40.470 cobra_shot Fluffy_Pillow 46.5/100: 46% focus focus_fire, lord_blastingtons_scope_of_doom
4:41.875 kill_shot Fluffy_Pillow 70.5/100: 70% focus focus_fire, lord_blastingtons_scope_of_doom
4:42.879 kill_shot Fluffy_Pillow 90.2/100: 90% focus focus_fire
4:43.884 kill_command Fluffy_Pillow 98.0/100: 98% focus focus_fire
4:44.887 arcane_shot Fluffy_Pillow 65.7/100: 66% focus focus_fire
4:45.892 cobra_shot Fluffy_Pillow 43.4/100: 43% focus focus_fire
4:47.297 cobra_shot Fluffy_Pillow 53.5/100: 53% focus focus_fire, exquisite_proficiency
4:48.701 arcane_shot Fluffy_Pillow 77.5/100: 77% focus focus_fire, exquisite_proficiency
4:49.705 arcane_shot Fluffy_Pillow 67.2/100: 67% focus cobra_strikes, focus_fire, exquisite_proficiency
4:50.710 kill_command Fluffy_Pillow 43.0/100: 43% focus cobra_strikes, focus_fire, exquisite_proficiency

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 935 891 891
Agility 3357 2935 2860 (1067)
Stamina 3447 3134 3134
Intellect 895 853 853
Spirit 710 710 710
Health 206820 188040 0
Focus 100 100 0
Crit 25.69% 19.78% 526
Haste 9.86% 4.63% 463
Multistrike 11.42% 6.42% 424
Damage / Heal Versatility 5.32% 2.32% 301
Attack Power 3693 2935 0
Mastery 35.16% 24.68% 477
Armor 1077 1077 1077

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimaera
30 Binding Shot Wyvern Sting Intimidation
45 Exhilaration Iron Hawk Spirit Bond
60 Steady Focus Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strikes Stampede
90 Glaive Toss Powershot Barrage
100 Exotic Munitions Focusing Shot (Beast Mastery Hunter) Adaptation (Beast Mastery Hunter)

Profile

hunter="Mekkasus"
origin="http://eu.battle.net/wow/en/character/forscherliga/Mekkasus/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/225/48476385-avatar.jpg"
level=100
race=dwarf
role=attack
position=ranged_back
professions=alchemy=602/herbalism=693
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ya!2021002
glyphs=animal_bond/disengage/deterrence/tame_beast/fetch/stampede
spec=beast_mastery

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/exotic_munitions,ammo_type=poisoned,if=active_enemies<3
actions.precombat+=/exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=draenic_agility,if=!talent.stampede.enabled&buff.bestial_wrath.up&target.health.pct<=20|target.time_to_die<=20
actions+=/potion,name=draenic_agility,if=talent.stampede.enabled&cooldown.stampede.remains<1&(buff.bloodlust.up|buff.focus_fire.up)|target.time_to_die<=25
actions+=/stampede,if=buff.bloodlust.up|buff.focus_fire.up|target.time_to_die<=25
actions+=/dire_beast
actions+=/explosive_trap,if=active_enemies>1
actions+=/bestial_wrath,if=focus>60&!buff.bestial_wrath.up
actions+=/barrage,if=active_enemies>1
actions+=/multishot,if=active_enemies>5|(active_enemies>1&pet.cat.buff.beast_cleave.down)
actions+=/focus_fire,five_stacks=1
actions+=/barrage,if=active_enemies>1
actions+=/a_murder_of_crows
actions+=/kill_shot,if=focus.time_to_max>gcd
actions+=/kill_command
actions+=/focusing_shot,if=focus<50
# Cast a second shot for steady focus if that won't cap us.
actions+=/cobra_shot,if=buff.pre_steady_focus.up&(14+cast_regen)<=focus.deficit
actions+=/glaive_toss
actions+=/barrage
actions+=/powershot,if=focus.time_to_max>cast_time
actions+=/cobra_shot,if=active_enemies>5
actions+=/arcane_shot,if=(buff.thrill_of_the_hunt.react&focus>35)|buff.bestial_wrath.up
actions+=/arcane_shot,if=focus>=64
actions+=/cobra_shot

head=wayfaring_helm,id=116188,bonus_id=70/525/536
neck=stormshot_choker,id=109950,bonus_id=499/524
shoulders=stormsteppe_pauldrons,id=114703
back=dunewalker_wrap,id=118807
chest=wayfaring_tunic,id=116191,bonus_id=106/525/535
wrists=primal_combatants_armbands_of_cruelty,id=115100
hands=sharpeye_gauntlets,id=109853,bonus_id=524
waist=stormsteppe_belt,id=114706
legs=wayfaring_leggings,id=116189,bonus_id=215/525/535
feet=sharpeye_greaves,id=109791,bonus_id=524
finger1=solium_band_of_dexterity,id=118292
finger2=talon_guard_bloodsworn_signet,id=118068
trinket1=smoldering_heart_of_hyperious,id=116799
trinket2=rabid_talbuk_horn,id=116824
main_hand=hellscreams_warbow,id=105670,gems=10agi_10agi_8agi,enchant=lord_blastingtons_scope_of_doom

# Gear Summary
# gear_agility=1516
# gear_stamina=2243
# gear_crit_rating=526
# gear_haste_rating=463
# gear_mastery_rating=454
# gear_armor=1077
# gear_multistrike_rating=424
# gear_versatility_rating=301
summon_pet=cat

Rapáx

Rapáx : 22994 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
22994.1 22994.1 4.7 / 0.021% 1506.5 / 6.6% 2368.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.6 Focus 0.00% 45.4 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Rapáx/advanced
Talents
  • 15: Crouching Tiger, Hidden Chimaera
  • 30: Binding Shot
  • 45: Spirit Bond
  • 60: Thrill of the Hunt
  • 75: A Murder of Crows
  • 90: Barrage
  • 100: Exotic Munitions
  • Talent Calculator
Glyphs
  • Glyph of Liberation
  • Glyph of Deterrence
  • Glyph of Animal Bond
  • Glyph of Aspect of the Pack
  • Glyph of Aspect of the Cheetah
  • Glyph of Tame Beast
Professions
  • leatherworking: 700
  • skinning: 700

Charts

http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Rap%C3%A1x+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:86938|63163|21567|19406|11485|4071|2183&chds=0,173876&chco=C79C6E,9482C9,C79C6E,C41F3B,69CCF0,ABD473,C79C6E&chm=t++86938++a_murder_of_crows,C79C6E,0,0,15|t++63163++black_arrow,9482C9,1,0,15|t++21567++barrage,C79C6E,2,0,15|t++19406++explosive_shot,C41F3B,3,0,15|t++11485++arcane_shot,69CCF0,4,0,15|t++4071++cobra_shot,ABD473,5,0,15|t++2183++auto_shot,C79C6E,6,0,15& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rap%C3%A1x+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:24,15,13,11,9,9,9,8,7,4,4&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,9482C9,C79C6E,C79C6E,ABD473,C79C6E,69CCF0,C79C6E,ABD473,C79C6E&chl=explosive_shot|serpent_sting|black_arrow|barrage|auto_shot|cobra_shot|cat: melee|arcane_shot|crow_peck|poisoned_ammo|cat: claw&
http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Rap%C3%A1x+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:adgkmquy144787542100yywuusqppopoooopqpooomnmllljkjiiiijjjkllmnnoooppoppooononnmmmmmmmmlllkkkjkjjjjjiijiiiijjjkkllkkkkkkklkkllllmmmnnnpopqpppoonnnmllkkjjjiijijjjkklkkkkjkjjjjjjijijjjkkkmlmnnoooooooooonnnnmmmmlmllmllkklkkkkkkjkkjjkkjklllllmmlmmmmmmmmnnnooopppqqrrrrrrqqqpooonmmlllllllmmmmmmmnnmmmmmmmmmlmmmmmnooppqrrssststtttsttsssrsrrsrrrrsrrsrrrqrrrrrrrrssssrssqpmkjgecZXV&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.661129,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=22994|max=34780&chxp=1,1,66,100 http://1.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Rap%C3%A1x+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,2,10,18,25,53,84,134,238,333,481,694,855,1085,1255,1555,1641,1778,1807,1762,1703,1637,1528,1275,1085,902,786,566,452,340,272,199,133,116,76,49,29,14,13,3,3,3,4,0,0,0,0,0,0,1&chds=0,1807&chbh=5&chxt=x&chxl=0:|min=21654|avg=22994|max=25093&chxp=0,1,39,100& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rap%C3%A1x+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:44.3,24.8,14.3,10.7,4.2,1.8&chds=0,100&chdls=ffffff&chco=ABD473,C41F3B,69CCF0,C79C6E,9482C9,C79C6E&chl=cobra_shot 133.2s|explosive_shot 74.7s|arcane_shot 43.0s|barrage 32.1s|black_arrow 12.5s|a_murder_of_crows 5.3s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Rapáx 22994
a_murder_of_crows 0 (1535) 0.0% (6.7%) 5.3 62.18sec 87322 86938

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 5.28 77.39 77.39 1.0045 1.0000 0.00 0.00 0.00 5577.48 86938.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.4 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target over the next {$d=15 seconds}. If the target dies while under attack, A Murder of Crows' cooldown is reset.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    crow_peck 1535 6.7% 0.0 0.00sec 0 0 Direct 77.4 4110 8253 5499 33.5% 21.6 1233 2476 33.7%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 77.39 0.00 0.00 0.0000 0.0000 461207.02 708802.36 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.27 33.66% 2476.25 2317 2899 2475.12 0 2899 17990 27648 34.90
multistrike 14.32 66.34% 1232.81 1158 1449 1233.35 1158 1408 17651 27127 34.93
hit 51.44 66.48% 4110.40 3861 4831 4111.73 3906 4454 211453 324971 34.93
crit 25.94 33.52% 8253.39 7722 9662 8257.20 7722 9123 214113 329057 34.93
 
DPS Timeline Chart
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.170000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
arcane_shot 1644 7.1% 42.8 7.04sec 11536 11485 Direct 42.5 7913 15852 10555 33.3% 11.9 2849 5708 33.2%  

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.80 42.50 0.00 0.00 1.0045 0.0000 493805.04 493805.04 0.00 11484.91 11484.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.95 33.19% 5708.44 5512 6582 5593.52 0 6582 22539 22539 0.00
multistrike 7.95 66.81% 2848.72 2756 3291 2848.14 0 3291 22641 22641 0.00
hit 28.36 66.72% 7913.30 7656 9142 7916.21 7656 8438 224426 224426 0.00
crit 14.14 33.28% 15851.81 15312 18284 15857.51 15312 18284 224200 224200 0.00
 
DPS Timeline Chart
 

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:An instant shot that causes $sw2 Arcane damage.$?p131564[ Grants {$142978s1=122} PvP Power for {$142978d=6 seconds}.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.26
 
auto_shot 1925 8.4% 106.0 2.85sec 5459 2183 Direct 106.0 3718 7450 4960 33.3% 29.6 1339 2683 33.3%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.00 106.00 0.00 0.00 2.5007 0.0000 578614.96 889239.83 34.93 2182.96 2182.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.86 33.31% 2682.83 2596 3107 2683.89 0 3107 26457 40660 34.93
multistrike 19.74 66.69% 1338.83 1298 1554 1339.38 1298 1474 26432 40621 34.93
hit 70.73 66.73% 3718.47 3605 4315 3720.14 3640 3815 263002 404193 34.93
crit 35.27 33.27% 7449.63 7210 8631 7453.19 7210 7861 262724 403766 34.93
 
DPS Timeline Chart
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
barrage 2304 10.0% 11.6 25.43sec 59515 21567 Periodic 185.8 2426 4858 3229 33.0% 52.0 1343 2689 33.1% 9.7%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.65 11.65 186.34 185.85 2.7595 0.1569 693114.74 1015263.88 31.73 21567.50 21567.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.65 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 17.2 33.06% 2688.74 2608 3115 2690.00 2608 2988 46256 46256 0.00
multistrike 34.8 66.94% 1342.72 1304 1557 1343.29 1304 1435 46777 46777 0.00
hit 124.5 66.98% 2426.10 2357 2815 2427.12 2357 2525 302024 464164 34.93
crit 61.4 33.02% 4857.51 4715 5630 4859.68 4715 5112 298057 458067 34.93
 
DPS Timeline Chart
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.69
 
black_arrow 2634 11.5% 12.5 25.03sec 63445 63163 Periodic 120.6 4472 8960 5964 33.2% 33.8 1610 3226 33.2% 80.2%

Stats details: black_arrow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.48 12.47 120.64 120.64 1.0045 2.0000 792003.92 792003.92 0.00 3120.32 63163.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.35 66.99% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.12 33.01% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 11.2 33.18% 3226.30 3102 3881 3228.01 3102 3881 36154 36154 0.00
multistrike 22.6 66.82% 1610.06 1551 1940 1610.97 1551 1773 36328 36328 0.00
hit 80.5 66.76% 4472.27 4308 5390 4474.89 4357 4642 360183 360183 0.00
crit 40.1 33.24% 8960.09 8616 10779 8965.74 8616 9599 359339 359339 0.00
 
DPS Timeline Chart
 

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:3674
  • name:Black Arrow
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.566720
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cobra_shot 1802 7.8% 78.7 3.75sec 6890 4071 Direct 78.5 4712 9434 6276 33.1% 21.9 1696 3396 33.2%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.67 78.49 0.00 0.00 1.6928 0.0000 542037.36 542037.36 0.00 4070.57 4070.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.25 33.16% 3396.22 3307 3949 3393.86 0 3949 24636 24636 0.00
multistrike 14.62 66.84% 1696.28 1654 1975 1697.03 1654 1975 24797 24797 0.00
hit 52.48 66.87% 4711.66 4594 5485 4713.50 4594 4883 247287 247287 0.00
crit 26.00 33.13% 9434.13 9187 10970 9437.88 9187 10079 245318 245318 0.00
 
DPS Timeline Chart
 

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:
  • description:Deals $sw2 Nature damage and generates {$91954s1=14} Focus. Usable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.76
 
explosive_shot 4820 21.0% 74.3 4.04sec 19494 19406 Direct 74.1 3355 6723 4475 33.3% 20.7 1208 2420 33.2%  
Periodic 167.5 4411 8829 5882 33.3% 46.8 1588 3180 33.2% 55.7%

Stats details: explosive_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.35 74.12 167.50 167.50 1.0045 1.0000 1449288.19 1449288.19 0.00 5984.29 19406.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.87 33.24% 2419.78 2326 2910 2418.86 0 2910 16626 16626 0.00
multistrike 13.80 66.76% 1207.61 1163 1455 1208.26 1163 1455 16664 16664 0.00
hit 49.47 66.74% 3354.91 3231 4042 3356.84 3231 3533 165964 165964 0.00
crit 24.65 33.26% 6722.53 6462 8085 6726.73 6462 7321 165729 165729 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 15.6 33.23% 3179.66 2326 8445 3179.83 2326 4834 49463 49463 0.00
multistrike 31.3 66.77% 1588.21 1163 4273 1588.12 1250 2144 49643 49643 0.00
hit 111.7 66.71% 4411.13 3231 11871 4410.87 3860 5380 492933 492933 0.00
crit 55.8 33.29% 8829.26 6462 23570 8829.18 7411 11046 492266 492266 0.00
 
DPS Timeline Chart
 

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.552552
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 

Action details: explosive_shot_tick

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
poisoned_ammo 817 3.6% 106.0 2.85sec 2318 0 Periodic 149.9 1231 2453 1639 33.4% 0.0 0 0 0.0% 99.6%

Stats details: poisoned_ammo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.98 0.00 149.89 149.89 0.0000 2.0000 245681.28 245681.28 0.00 819.57 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.9 66.62% 1231.21 278 1719 1231.72 1179 1305 122943 122943 0.00
crit 50.0 33.38% 2453.31 556 3438 2454.13 2264 2694 122738 122738 0.00
 
DPS Timeline Chart
 

Action details: poisoned_ammo

Static Values
  • id:170661
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:170661
  • name:Poisoned Ammo
  • school:nature
  • tooltip:Deals $w1 Nature damage every $t sec.
  • description:{$@spelldesc162537=Arms your ranged weapon with exotic ammunition that lasts for {$d=3600 seconds}. Each autoshot deals $170661o1 additional Nature damage over {$162543d=16 seconds}. When this effect is refreshed, the remaining damage will be added to the new effect.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
serpent_sting 2982 13.0% 42.5 7.06sec 21092 0 Periodic 140.4 4352 8714 5798 33.2% 39.2 1580 3164 33.2% 97.6%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.50 42.50 140.37 140.37 0.0000 2.0916 896495.39 896495.39 0.00 3053.51 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.36 66.72% 0.00 0 0 0.00 0 0 0 0 0.00
crit 14.15 33.28% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.0 33.16% 3163.55 3053 3820 3165.10 3053 3820 41155 41155 0.00
multistrike 26.2 66.84% 1580.06 1526 1910 1580.93 1526 1718 41429 41429 0.00
hit 93.8 66.84% 4352.15 0 5305 4354.37 4154 4540 408359 408359 0.00
crit 46.5 33.16% 8714.02 3 10610 8718.73 8052 9412 405552 405552 0.00
 
DPS Timeline Chart
 

Action details: serpent_sting

Static Values
  • id:118253
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118253
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes $o1 Nature damage over {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.725402
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - cat 2531 / 2531
claw 739 3.2% 73.0 4.17sec 3040 3027 Direct 73.0 1949 3927 2806 43.3% 20.3 584 1178 43.3%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.98 72.98 0.00 0.00 1.0045 0.0000 221871.62 340981.65 34.93 3026.69 3026.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.81 43.32% 1178.44 1089 2725 1179.50 0 2725 10384 15959 34.92
multistrike 11.53 56.68% 584.14 544 1362 584.70 544 1362 6735 10351 34.93
hit 41.37 56.68% 1948.68 1815 4541 1950.53 1815 2161 80608 123882 34.93
crit 31.61 43.32% 3927.15 3629 9082 3931.83 3629 4539 124144 190789 34.93
 
DPS Timeline Chart
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 1792 7.8% 196.5 1.53sec 2740 1794 Direct 196.5 1763 3533 2528 43.2% 54.9 529 1060 43.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.49 196.49 0.00 0.00 1.5274 0.0000 538401.73 827438.44 34.93 1794.00 1794.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 23.77 43.26% 1059.87 1018 1274 1060.51 1018 1172 25192 38716 34.93
multistrike 31.18 56.74% 528.88 509 637 529.20 509 580 16490 25342 34.93
hit 111.56 56.78% 1763.13 1697 2123 1764.12 1721 1824 196694 302287 34.93
crit 84.93 43.22% 3532.54 3394 4246 3534.64 3431 3669 300026 461093 34.93
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
Rapáx
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
exotic_munitions 1.0 0.00sec

Stats details: exotic_munitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: exotic_munitions

Static Values
  • id:162534
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:active_enemies<3
Spelldata
  • id:162534
  • name:Exotic Munitions
  • school:physical
  • tooltip:
  • description:Allows you to modify your ranged weapon to use exotic munitions: $@spellname162536 {$@spelldesc162536=Arms your ranged weapon with exotic ammunition that lasts for {$d=3600 seconds}. Each autoshot deals $162541sw1 additional Fire damage to all enemies within $162541A1 yards of the initial target.} $@spellname162537 {$@spelldesc162537=Arms your ranged weapon with exotic ammunition that lasts for {$d=3600 seconds}. Each autoshot deals $170661o1 additional Nature damage over {$162543d=16 seconds}. When this effect is refreshed, the remaining damage will be added to the new effect.} $@spellname162539 {$@spelldesc162539=Arms your ranged weapon with exotic ammunition that lasts for {$d=3600 seconds}. Each autoshot deals $162546sw1 additional Frost damage and reduces the target's movement speed by {$162546s2=50}% for {$162546d=4 seconds}.} Only one exotic munition can be active at one time.
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: summon_pet

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 42.86% 0.0(0.0)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_agility_potion 2.0 0.0 275.9sec 0.0sec 14.89% 14.90% 0.0(0.0)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:14.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lock_and_load 14.9 0.2 20.0sec 19.6sec 8.78% 40.03% 0.2(0.2)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lock_and_load_1:5.00%
  • lock_and_load_2:3.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:168980
  • name:Lock and Load
  • tooltip:Your Explosive Shot triggers no cooldown.
  • description:{$@spelldesc3674=Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
megawatt_filament 7.2 2.4 43.8sec 31.5sec 32.86% 32.87% 2.4(2.4)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_megawatt_filament
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:750.00

Stack Uptimes

  • megawatt_filament_1:32.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156060
  • name:Megawatt Filament
  • tooltip:Critical strike increased by $w1.
  • description:Critical strike increased by {$s1=750}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
thrill_of_the_hunt 10.9 3.8 27.2sec 19.9sec 32.97% 79.36% 3.8(7.8)

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_thrill_of_the_hunt
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • thrill_of_the_hunt_1:7.67%
  • thrill_of_the_hunt_2:10.59%
  • thrill_of_the_hunt_3:14.72%

Trigger Attempt Success

  • trigger_pct:13.05%

Spelldata details

  • id:34720
  • name:Thrill of the Hunt
  • tooltip:Reduces the Focus cost of your next Arcane Shot, Aimed Shot, or Multi-Shot by {$s1=20}.
  • description:{$@spelldesc109306=You have a {$s1=6}% chance per 10 Focus spent on Focus-costing attacks to trigger Thrill of the Hunt. Thrill of the Hunt reduces the Focus cost of your next {$s2=3} Arcane Shots, Aimed Shots, or Multi-Shots by {$34720s1=20}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Rapáx
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rapáx
a_murder_of_crows Focus 5.3 158.4 30.0 30.0 2910.8
arcane_shot Focus 42.8 636.1 14.9 14.9 776.3
barrage Focus 11.6 698.8 60.0 60.0 991.9
black_arrow Focus 12.5 436.9 35.0 35.0 1812.7
explosive_shot Focus 74.3 667.2 9.0 9.0 2172.2
pet - cat
claw Focus 73.0 1874.4 25.7 25.7 118.4
Resource Gains Type Count Total Average Overflow
focus_regen Focus 224.65 1420.50 (44.36%) 6.32 8.74 0.61%
external_healing Health 7.89 0.00 (0.00%) 0.00 73750.77 100.00%
thrill_of_the_hunt_savings Focus 34.28 685.64 (21.41%) 20.00 0.00 0.00%
cobra_shot Focus 78.49 1096.26 (34.23%) 13.97 2.56 0.23%
pet - cat
focus_regen Focus 300.41 1786.93 (100.00%) 5.95 0.00 0.00%
Resource RPS-Gain RPS-Loss
Focus 8.36 8.63
Combat End Resource Mean Min Max
Focus 19.21 0.01 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.3%
cat-Focus Cap 0.3%
devilsaur-Focus Cap 0.3%
raptor-Focus Cap 0.3%
hyena-Focus Cap 0.3%
wolf-Focus Cap 0.3%
wasp-Focus Cap 0.3%
t17_pet_2-Focus Cap 0.3%
t17_pet_1-Focus Cap 0.3%
dire_beast_1-Focus Cap 0.3%
dire_beast_2-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%
tier15_thunderhawk-Focus Cap 0.3%

Procs

Count Interval
starved: black_arrow 2.3 33.9sec
starved: explosive_shot 0.7 55.1sec
starved: a_murder_of_crows 1.3 41.4sec
starved: barrage 16.7 17.4sec
thrill_of_the_hunt 14.6 19.8sec
lock_and_load 15.1 19.6sec

Statistics & Data Analysis

Fight Length
Sample Data Rapáx Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Rapáx Damage Per Second
Count 25000
Mean 22994.05
Minimum 21654.00
Maximum 25093.28
Spread ( max - min ) 3439.27
Range [ ( max - min ) / 2 * 100% ] 7.48%
Standard Deviation 381.9197
5th Percentile 22393.44
95th Percentile 23649.67
( 95th Percentile - 5th Percentile ) 1256.23
Mean Distribution
Standard Deviation 2.4155
95.00% Confidence Intervall ( 22989.32 - 22998.79 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 1059
0.1 Scale Factor Error with Delta=300 1245
0.05 Scale Factor Error with Delta=300 4980
0.01 Scale Factor Error with Delta=300 124516
Distribution Chart
DPS(e)
Sample Data Rapáx Damage Per Second (Effective)
Count 25000
Mean 22994.05
Minimum 21654.00
Maximum 25093.28
Spread ( max - min ) 3439.27
Range [ ( max - min ) / 2 * 100% ] 7.48%
Damage
Sample Data Rapáx Damage
Count 25000
Mean 6152247.89
Minimum 4577943.77
Maximum 7782769.38
Spread ( max - min ) 3204825.61
Range [ ( max - min ) / 2 * 100% ] 26.05%
DTPS
Sample Data Rapáx Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rapáx Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Rapáx Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rapáx Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rapáx Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rapáx Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data RapáxTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Rapáx Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 exotic_munitions,ammo_type=poisoned,if=active_enemies<3
5 0.00 exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
6 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
8 0.00 arcane_torrent,if=focus.deficit>=30
9 0.00 blood_fury
A 0.00 berserking
B 1.00 potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
C 0.00 call_action_list,name=aoe,if=active_enemies>1
D 0.00 stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
E 12.48 black_arrow,if=!ticking
F 74.35 explosive_shot
G 5.28 a_murder_of_crows
H 0.00 dire_beast
I 39.70 arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
J 0.00 glaive_toss
K 0.00 powershot
L 11.65 barrage
M 0.00 cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Cast a second shot for steady focus if that won't cap us.
N 3.11 arcane_shot,if=focus>=80|talent.focusing_shot.enabled
O 0.00 focusing_shot
P 79.08 cobra_shot

Sample Sequence

012467EFGIPPPFLPPIFIFFFIPPNEFPPLPFPPFFFNPPNFIIIEPFPPLFFFFPGIPFPPEIFPPIIFFFFPPLFPPPEFIPPPFIIFFFILPFPIIEPFPFFFGPPPFLIPPFEPPPFFFIPPLFPPPFIEPPFFFFPLIFPPPFGPEPFIPPPFLPFFFIFFFPPEPFPPIIFIPFFFLPPFPEPIFPGPPFPLPBFFFFFFEPPIFPIIIPFIPPI

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 100.0/100: 100% focus
Pre food Fluffy_Pillow 100.0/100: 100% focus
Pre summon_pet Fluffy_Pillow 100.0/100: 100% focus
Pre exotic_munitions Fluffy_Pillow 100.0/100: 100% focus
Pre potion Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 start_auto_shot Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 black_arrow Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:01.004 explosive_shot Fluffy_Pillow 71.0/100: 71% focus bloodlust, megawatt_filament, draenic_agility_potion
0:02.007 a_murder_of_crows Fluffy_Pillow 61.9/100: 62% focus bloodlust, megawatt_filament, draenic_agility_potion
0:03.012 arcane_shot Fluffy_Pillow 37.9/100: 38% focus bloodlust, megawatt_filament, draenic_agility_potion
0:04.017 cobra_shot Fluffy_Pillow 13.9/100: 14% focus bloodlust, megawatt_filament, draenic_agility_potion
0:05.366 cobra_shot Fluffy_Pillow 21.9/100: 22% focus bloodlust, megawatt_filament, draenic_agility_potion
0:06.715 cobra_shot Fluffy_Pillow 43.9/100: 44% focus bloodlust, megawatt_filament, draenic_agility_potion
0:08.063 explosive_shot Fluffy_Pillow 66.0/100: 66% focus bloodlust, megawatt_filament, draenic_agility_potion
0:09.067 barrage Fluffy_Pillow 70.9/100: 71% focus bloodlust, thrill_of_the_hunt(3), megawatt_filament, draenic_agility_potion
0:11.331 cobra_shot Fluffy_Pillow 24.4/100: 24% focus bloodlust, thrill_of_the_hunt(3), megawatt_filament, draenic_agility_potion
0:12.680 cobra_shot Fluffy_Pillow 32.4/100: 32% focus bloodlust, thrill_of_the_hunt(3), draenic_agility_potion
0:14.028 arcane_shot Fluffy_Pillow 54.4/100: 54% focus bloodlust, thrill_of_the_hunt(3), draenic_agility_potion
0:15.032 explosive_shot Fluffy_Pillow 64.4/100: 64% focus bloodlust, thrill_of_the_hunt(2), draenic_agility_potion
0:16.038 arcane_shot Fluffy_Pillow 55.4/100: 55% focus bloodlust, thrill_of_the_hunt(2), draenic_agility_potion
0:17.045 explosive_shot Fluffy_Pillow 51.4/100: 51% focus bloodlust, thrill_of_the_hunt, lock_and_load(2), draenic_agility_potion
0:18.051 explosive_shot Fluffy_Pillow 57.4/100: 57% focus bloodlust, thrill_of_the_hunt, lock_and_load, draenic_agility_potion
0:19.056 explosive_shot Fluffy_Pillow 63.4/100: 63% focus bloodlust, thrill_of_the_hunt, draenic_agility_potion
0:20.060 arcane_shot Fluffy_Pillow 54.3/100: 54% focus bloodlust, thrill_of_the_hunt
0:21.064 cobra_shot Fluffy_Pillow 50.3/100: 50% focus bloodlust
0:22.413 cobra_shot Fluffy_Pillow 58.3/100: 58% focus bloodlust
0:23.762 arcane_shot Fluffy_Pillow 80.4/100: 80% focus bloodlust
0:24.765 black_arrow Fluffy_Pillow 70.3/100: 70% focus bloodlust
0:25.768 explosive_shot Fluffy_Pillow 41.3/100: 41% focus bloodlust
0:26.772 cobra_shot Fluffy_Pillow 32.3/100: 32% focus bloodlust
0:28.119 cobra_shot Fluffy_Pillow 40.3/100: 40% focus bloodlust
0:29.466 barrage Fluffy_Pillow 62.3/100: 62% focus bloodlust
0:31.704 cobra_shot Fluffy_Pillow 29.6/100: 30% focus bloodlust
0:33.052 explosive_shot Fluffy_Pillow 37.6/100: 38% focus bloodlust
0:34.056 cobra_shot Fluffy_Pillow 42.6/100: 43% focus bloodlust
0:35.405 cobra_shot Fluffy_Pillow 50.6/100: 51% focus bloodlust
0:36.753 explosive_shot Fluffy_Pillow 72.6/100: 73% focus bloodlust, lock_and_load(2)
0:37.758 explosive_shot Fluffy_Pillow 92.6/100: 93% focus bloodlust, lock_and_load
0:38.763 explosive_shot Fluffy_Pillow 98.6/100: 99% focus bloodlust
0:39.767 arcane_shot Fluffy_Pillow 89.6/100: 90% focus bloodlust
0:40.770 cobra_shot Fluffy_Pillow 65.5/100: 66% focus bloodlust
0:42.119 cobra_shot Fluffy_Pillow 71.7/100: 72% focus
0:43.872 arcane_shot Fluffy_Pillow 93.7/100: 94% focus
0:44.877 explosive_shot Fluffy_Pillow 82.3/100: 82% focus
0:45.880 arcane_shot Fluffy_Pillow 71.9/100: 72% focus thrill_of_the_hunt(3)
0:46.884 arcane_shot Fluffy_Pillow 66.5/100: 67% focus thrill_of_the_hunt(2)
0:47.887 arcane_shot Fluffy_Pillow 61.1/100: 61% focus thrill_of_the_hunt
0:48.892 black_arrow Fluffy_Pillow 55.7/100: 56% focus
0:49.896 cobra_shot Fluffy_Pillow 25.3/100: 25% focus
0:51.647 explosive_shot Fluffy_Pillow 33.3/100: 33% focus
0:52.651 cobra_shot Fluffy_Pillow 36.9/100: 37% focus
0:54.404 cobra_shot Fluffy_Pillow 44.9/100: 45% focus megawatt_filament
0:56.156 barrage Fluffy_Pillow 66.9/100: 67% focus thrill_of_the_hunt(3), megawatt_filament
0:59.011 explosive_shot Fluffy_Pillow 34.0/100: 34% focus thrill_of_the_hunt(3), megawatt_filament
1:00.016 explosive_shot Fluffy_Pillow 23.6/100: 24% focus thrill_of_the_hunt(3), lock_and_load(2), megawatt_filament
1:01.019 explosive_shot Fluffy_Pillow 28.2/100: 28% focus thrill_of_the_hunt(3), lock_and_load, megawatt_filament
1:02.023 explosive_shot Fluffy_Pillow 32.8/100: 33% focus thrill_of_the_hunt(3), megawatt_filament
1:03.027 cobra_shot Fluffy_Pillow 22.4/100: 22% focus thrill_of_the_hunt(3), megawatt_filament
1:04.778 a_murder_of_crows Fluffy_Pillow 30.4/100: 30% focus thrill_of_the_hunt(3), megawatt_filament
1:05.783 arcane_shot Fluffy_Pillow 19.0/100: 19% focus thrill_of_the_hunt(3), megawatt_filament
1:06.787 cobra_shot Fluffy_Pillow 13.6/100: 14% focus thrill_of_the_hunt(2), megawatt_filament
1:08.539 explosive_shot Fluffy_Pillow 21.6/100: 22% focus thrill_of_the_hunt(2)
1:09.545 cobra_shot Fluffy_Pillow 25.2/100: 25% focus thrill_of_the_hunt(3)
1:11.298 cobra_shot Fluffy_Pillow 33.2/100: 33% focus thrill_of_the_hunt(3)
1:13.050 black_arrow Fluffy_Pillow 55.2/100: 55% focus thrill_of_the_hunt(3)
1:14.054 arcane_shot Fluffy_Pillow 38.8/100: 39% focus thrill_of_the_hunt(3)
1:15.059 explosive_shot Fluffy_Pillow 33.4/100: 33% focus thrill_of_the_hunt(2)
1:16.065 cobra_shot Fluffy_Pillow 23.0/100: 23% focus thrill_of_the_hunt(2)
1:17.817 cobra_shot Fluffy_Pillow 31.0/100: 31% focus thrill_of_the_hunt(2)
1:19.569 arcane_shot Fluffy_Pillow 53.1/100: 53% focus thrill_of_the_hunt(2)
1:20.575 arcane_shot Fluffy_Pillow 61.7/100: 62% focus thrill_of_the_hunt
1:21.579 explosive_shot Fluffy_Pillow 56.3/100: 56% focus
1:22.583 explosive_shot Fluffy_Pillow 45.9/100: 46% focus lock_and_load(2)
1:23.587 explosive_shot Fluffy_Pillow 50.4/100: 50% focus lock_and_load
1:24.593 explosive_shot Fluffy_Pillow 55.1/100: 55% focus
1:25.599 cobra_shot Fluffy_Pillow 44.7/100: 45% focus
1:27.351 cobra_shot Fluffy_Pillow 52.7/100: 53% focus
1:29.105 barrage Fluffy_Pillow 74.7/100: 75% focus
1:31.946 explosive_shot Fluffy_Pillow 41.7/100: 42% focus
1:32.950 cobra_shot Fluffy_Pillow 31.3/100: 31% focus
1:34.705 cobra_shot Fluffy_Pillow 39.3/100: 39% focus
1:36.457 cobra_shot Fluffy_Pillow 61.3/100: 61% focus
1:38.208 black_arrow Fluffy_Pillow 83.4/100: 83% focus
1:39.211 explosive_shot Fluffy_Pillow 66.9/100: 67% focus
1:40.216 arcane_shot Fluffy_Pillow 56.5/100: 57% focus
1:41.220 cobra_shot Fluffy_Pillow 31.1/100: 31% focus
1:42.971 cobra_shot Fluffy_Pillow 39.1/100: 39% focus
1:44.725 cobra_shot Fluffy_Pillow 61.2/100: 61% focus
1:46.477 explosive_shot Fluffy_Pillow 83.2/100: 83% focus
1:47.480 arcane_shot Fluffy_Pillow 86.8/100: 87% focus thrill_of_the_hunt(3)
1:48.485 arcane_shot Fluffy_Pillow 81.4/100: 81% focus thrill_of_the_hunt(2)
1:49.488 explosive_shot Fluffy_Pillow 76.0/100: 76% focus thrill_of_the_hunt, lock_and_load(2)
1:50.491 explosive_shot Fluffy_Pillow 80.6/100: 81% focus thrill_of_the_hunt, lock_and_load
1:51.496 explosive_shot Fluffy_Pillow 85.2/100: 85% focus thrill_of_the_hunt
1:52.500 arcane_shot Fluffy_Pillow 74.7/100: 75% focus thrill_of_the_hunt
1:53.505 barrage Fluffy_Pillow 69.3/100: 69% focus thrill_of_the_hunt(3)
1:56.342 cobra_shot Fluffy_Pillow 22.3/100: 22% focus thrill_of_the_hunt(3)
1:58.093 explosive_shot Fluffy_Pillow 30.3/100: 30% focus thrill_of_the_hunt(3)
1:59.099 cobra_shot Fluffy_Pillow 33.9/100: 34% focus thrill_of_the_hunt(3)
2:00.851 arcane_shot Fluffy_Pillow 42.0/100: 42% focus thrill_of_the_hunt(3), megawatt_filament
2:01.856 arcane_shot Fluffy_Pillow 50.6/100: 51% focus thrill_of_the_hunt(2), megawatt_filament
2:02.863 black_arrow Fluffy_Pillow 45.2/100: 45% focus thrill_of_the_hunt, megawatt_filament
2:03.869 cobra_shot Fluffy_Pillow 14.8/100: 15% focus thrill_of_the_hunt, megawatt_filament
2:05.622 explosive_shot Fluffy_Pillow 22.8/100: 23% focus thrill_of_the_hunt, megawatt_filament
2:06.626 cobra_shot Fluffy_Pillow 26.4/100: 26% focus thrill_of_the_hunt, megawatt_filament
2:08.379 explosive_shot Fluffy_Pillow 34.4/100: 34% focus thrill_of_the_hunt, lock_and_load(2), megawatt_filament
2:09.382 explosive_shot Fluffy_Pillow 53.0/100: 53% focus thrill_of_the_hunt, lock_and_load, megawatt_filament
2:10.386 explosive_shot Fluffy_Pillow 57.6/100: 58% focus thrill_of_the_hunt, megawatt_filament
2:11.389 a_murder_of_crows Fluffy_Pillow 47.2/100: 47% focus thrill_of_the_hunt, megawatt_filament
2:12.394 cobra_shot Fluffy_Pillow 21.8/100: 22% focus thrill_of_the_hunt
2:14.145 cobra_shot Fluffy_Pillow 29.8/100: 30% focus
2:15.897 cobra_shot Fluffy_Pillow 51.8/100: 52% focus
2:17.650 explosive_shot Fluffy_Pillow 73.8/100: 74% focus
2:18.655 barrage Fluffy_Pillow 77.4/100: 77% focus
2:21.541 arcane_shot Fluffy_Pillow 30.6/100: 31% focus
2:22.546 cobra_shot Fluffy_Pillow 5.2/100: 5% focus
2:24.299 cobra_shot Fluffy_Pillow 13.3/100: 13% focus
2:26.051 explosive_shot Fluffy_Pillow 35.3/100: 35% focus megawatt_filament
2:27.055 black_arrow Fluffy_Pillow 38.9/100: 39% focus megawatt_filament
2:28.058 cobra_shot Fluffy_Pillow 8.5/100: 8% focus megawatt_filament
2:29.810 cobra_shot Fluffy_Pillow 16.5/100: 16% focus megawatt_filament
2:31.563 cobra_shot Fluffy_Pillow 38.5/100: 38% focus megawatt_filament
2:33.313 explosive_shot Fluffy_Pillow 60.5/100: 61% focus lock_and_load(2), megawatt_filament
2:34.317 explosive_shot Fluffy_Pillow 79.1/100: 79% focus lock_and_load, megawatt_filament
2:35.322 explosive_shot Fluffy_Pillow 83.7/100: 84% focus megawatt_filament
2:36.326 arcane_shot Fluffy_Pillow 73.3/100: 73% focus megawatt_filament
2:37.330 cobra_shot Fluffy_Pillow 47.9/100: 48% focus megawatt_filament
2:39.084 cobra_shot Fluffy_Pillow 55.9/100: 56% focus
2:40.837 barrage Fluffy_Pillow 77.9/100: 78% focus
2:43.746 explosive_shot Fluffy_Pillow 45.2/100: 45% focus
2:44.749 cobra_shot Fluffy_Pillow 34.8/100: 35% focus
2:46.503 cobra_shot Fluffy_Pillow 42.9/100: 43% focus
2:48.256 cobra_shot Fluffy_Pillow 64.9/100: 65% focus
2:50.007 explosive_shot Fluffy_Pillow 86.9/100: 87% focus
2:51.012 arcane_shot Fluffy_Pillow 90.5/100: 90% focus
2:52.016 black_arrow Fluffy_Pillow 65.1/100: 65% focus
2:53.018 cobra_shot Fluffy_Pillow 34.7/100: 35% focus
2:54.770 cobra_shot Fluffy_Pillow 42.7/100: 43% focus
2:56.524 explosive_shot Fluffy_Pillow 64.7/100: 65% focus megawatt_filament
2:57.528 explosive_shot Fluffy_Pillow 68.3/100: 68% focus lock_and_load(2), megawatt_filament
2:58.532 explosive_shot Fluffy_Pillow 72.9/100: 73% focus lock_and_load, megawatt_filament
2:59.537 explosive_shot Fluffy_Pillow 77.5/100: 78% focus megawatt_filament
3:00.541 cobra_shot Fluffy_Pillow 67.1/100: 67% focus megawatt_filament
3:02.296 barrage Fluffy_Pillow 75.1/100: 75% focus megawatt_filament
3:05.150 arcane_shot Fluffy_Pillow 42.2/100: 42% focus megawatt_filament
3:06.154 explosive_shot Fluffy_Pillow 16.8/100: 17% focus megawatt_filament
3:07.159 cobra_shot Fluffy_Pillow 6.4/100: 6% focus megawatt_filament
3:08.912 cobra_shot Fluffy_Pillow 14.4/100: 14% focus megawatt_filament
3:10.665 cobra_shot Fluffy_Pillow 36.4/100: 36% focus megawatt_filament
3:12.417 explosive_shot Fluffy_Pillow 58.4/100: 58% focus megawatt_filament
3:13.420 a_murder_of_crows Fluffy_Pillow 62.0/100: 62% focus megawatt_filament
3:14.425 cobra_shot Fluffy_Pillow 36.6/100: 37% focus megawatt_filament
3:16.178 black_arrow Fluffy_Pillow 44.6/100: 45% focus megawatt_filament
3:17.182 cobra_shot Fluffy_Pillow 28.2/100: 28% focus megawatt_filament
3:18.935 explosive_shot Fluffy_Pillow 36.3/100: 36% focus megawatt_filament
3:19.939 arcane_shot Fluffy_Pillow 39.9/100: 40% focus megawatt_filament
3:20.942 cobra_shot Fluffy_Pillow 14.4/100: 14% focus
3:22.695 cobra_shot Fluffy_Pillow 22.5/100: 22% focus megawatt_filament
3:24.448 cobra_shot Fluffy_Pillow 44.5/100: 44% focus megawatt_filament
3:26.200 explosive_shot Fluffy_Pillow 66.5/100: 67% focus megawatt_filament
3:27.206 barrage Fluffy_Pillow 70.1/100: 70% focus megawatt_filament
3:30.085 cobra_shot Fluffy_Pillow 23.3/100: 23% focus megawatt_filament
3:31.838 explosive_shot Fluffy_Pillow 31.3/100: 31% focus lock_and_load(2), megawatt_filament
3:32.843 explosive_shot Fluffy_Pillow 49.9/100: 50% focus lock_and_load, megawatt_filament
3:33.848 explosive_shot Fluffy_Pillow 54.5/100: 55% focus megawatt_filament
3:34.854 arcane_shot Fluffy_Pillow 44.1/100: 44% focus megawatt_filament
3:35.858 explosive_shot Fluffy_Pillow 18.7/100: 19% focus lock_and_load(2), megawatt_filament
3:36.861 explosive_shot Fluffy_Pillow 23.3/100: 23% focus lock_and_load, megawatt_filament
3:37.865 explosive_shot Fluffy_Pillow 27.9/100: 28% focus megawatt_filament
3:38.869 cobra_shot Fluffy_Pillow 17.5/100: 17% focus megawatt_filament
3:40.622 cobra_shot Fluffy_Pillow 25.5/100: 25% focus megawatt_filament
3:42.373 black_arrow Fluffy_Pillow 47.5/100: 48% focus megawatt_filament
3:43.377 cobra_shot Fluffy_Pillow 31.1/100: 31% focus megawatt_filament
3:45.128 explosive_shot Fluffy_Pillow 39.1/100: 39% focus megawatt_filament
3:46.133 cobra_shot Fluffy_Pillow 42.7/100: 43% focus megawatt_filament
3:47.886 cobra_shot Fluffy_Pillow 50.7/100: 51% focus megawatt_filament
3:49.639 arcane_shot Fluffy_Pillow 72.8/100: 73% focus megawatt_filament
3:50.643 arcane_shot Fluffy_Pillow 61.4/100: 61% focus thrill_of_the_hunt(2), megawatt_filament
3:51.646 explosive_shot Fluffy_Pillow 55.9/100: 56% focus thrill_of_the_hunt, megawatt_filament
3:52.649 arcane_shot Fluffy_Pillow 45.5/100: 46% focus thrill_of_the_hunt
3:53.654 cobra_shot Fluffy_Pillow 40.1/100: 40% focus
3:55.407 explosive_shot Fluffy_Pillow 48.2/100: 48% focus lock_and_load(2)
3:56.411 explosive_shot Fluffy_Pillow 66.7/100: 67% focus lock_and_load
3:57.414 explosive_shot Fluffy_Pillow 71.3/100: 71% focus
3:58.419 barrage Fluffy_Pillow 60.9/100: 61% focus
4:01.395 cobra_shot Fluffy_Pillow 14.6/100: 15% focus
4:03.147 cobra_shot Fluffy_Pillow 22.6/100: 23% focus
4:04.899 explosive_shot Fluffy_Pillow 44.6/100: 45% focus
4:05.902 cobra_shot Fluffy_Pillow 48.2/100: 48% focus
4:07.656 black_arrow Fluffy_Pillow 56.2/100: 56% focus
4:08.662 cobra_shot Fluffy_Pillow 39.8/100: 40% focus
4:10.416 arcane_shot Fluffy_Pillow 47.8/100: 48% focus
4:11.420 explosive_shot Fluffy_Pillow 36.4/100: 36% focus
4:12.425 cobra_shot Fluffy_Pillow 26.0/100: 26% focus
4:14.178 a_murder_of_crows Fluffy_Pillow 34.0/100: 34% focus
4:15.183 cobra_shot Fluffy_Pillow 22.6/100: 23% focus
4:16.936 cobra_shot Fluffy_Pillow 30.7/100: 31% focus
4:18.689 explosive_shot Fluffy_Pillow 52.7/100: 53% focus
4:19.695 cobra_shot Fluffy_Pillow 56.3/100: 56% focus
4:21.447 barrage Fluffy_Pillow 64.3/100: 64% focus
4:24.186 cobra_shot Fluffy_Pillow 30.8/100: 31% focus
4:25.939 potion Fluffy_Pillow 38.9/100: 39% focus
4:25.939 explosive_shot Fluffy_Pillow 38.9/100: 39% focus draenic_agility_potion
4:26.941 explosive_shot Fluffy_Pillow 42.4/100: 42% focus lock_and_load(2), draenic_agility_potion
4:27.946 explosive_shot Fluffy_Pillow 47.0/100: 47% focus lock_and_load, draenic_agility_potion
4:28.951 explosive_shot Fluffy_Pillow 51.6/100: 52% focus lock_and_load(2), draenic_agility_potion
4:29.954 explosive_shot Fluffy_Pillow 56.2/100: 56% focus lock_and_load, draenic_agility_potion
4:30.958 explosive_shot Fluffy_Pillow 60.8/100: 61% focus draenic_agility_potion
4:31.962 black_arrow Fluffy_Pillow 50.4/100: 50% focus draenic_agility_potion
4:32.967 cobra_shot Fluffy_Pillow 20.0/100: 20% focus draenic_agility_potion
4:34.719 cobra_shot Fluffy_Pillow 28.0/100: 28% focus draenic_agility_potion
4:36.470 arcane_shot Fluffy_Pillow 50.1/100: 50% focus draenic_agility_potion
4:37.474 explosive_shot Fluffy_Pillow 38.6/100: 39% focus thrill_of_the_hunt(2), draenic_agility_potion
4:38.479 cobra_shot Fluffy_Pillow 28.2/100: 28% focus thrill_of_the_hunt(2), draenic_agility_potion
4:40.231 arcane_shot Fluffy_Pillow 36.3/100: 36% focus thrill_of_the_hunt(2), megawatt_filament, draenic_agility_potion
4:41.237 arcane_shot Fluffy_Pillow 44.9/100: 45% focus thrill_of_the_hunt(2), megawatt_filament, draenic_agility_potion
4:42.241 arcane_shot Fluffy_Pillow 39.5/100: 39% focus thrill_of_the_hunt, megawatt_filament, draenic_agility_potion
4:43.246 cobra_shot Fluffy_Pillow 34.1/100: 34% focus megawatt_filament, draenic_agility_potion
4:44.999 explosive_shot Fluffy_Pillow 42.1/100: 42% focus megawatt_filament, draenic_agility_potion
4:46.004 arcane_shot Fluffy_Pillow 45.7/100: 46% focus megawatt_filament, draenic_agility_potion
4:47.010 cobra_shot Fluffy_Pillow 20.3/100: 20% focus megawatt_filament, draenic_agility_potion
4:48.762 cobra_shot Fluffy_Pillow 28.3/100: 28% focus megawatt_filament, draenic_agility_potion
4:50.514 arcane_shot Fluffy_Pillow 50.3/100: 50% focus megawatt_filament, draenic_agility_potion

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 926 882 882
Agility 4391 3920 3798 (1378)
Stamina 4422 4020 4020
Intellect 896 854 854
Spirit 711 711 711
Health 265320 241200 0
Focus 100 100 0
Crit 33.97% 28.06% 1437
Haste 14.40% 8.95% 787
Multistrike 13.97% 8.97% 592
Damage / Heal Versatility 4.98% 1.98% 258
Attack Power 4830 3920 0
Mastery 15.27% 10.27% 250
Armor 1224 1224 1224

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimaera
30 Binding Shot Wyvern Sting Intimidation
45 Exhilaration Iron Hawk Spirit Bond
60 Steady Focus Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strikes Stampede
90 Glaive Toss Powershot Barrage
100 Exotic Munitions Focusing Shot (Survival Hunter) Lone Wolf

Profile

hunter="Rapáx"
origin="http://eu.battle.net/wow/en/character/forscherliga/Rapáx/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/202/480970-avatar.jpg"
level=100
race=night_elf
role=attack
position=ranged_back
professions=skinning=700/leatherworking=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Yb!2022020
glyphs=liberation/deterrence/animal_bond/aspect_of_the_pack/aspect_of_the_cheetah/tame_beast
spec=survival

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/exotic_munitions,ammo_type=poisoned,if=active_enemies<3
actions.precombat+=/exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
actions+=/call_action_list,name=aoe,if=active_enemies>1
actions+=/stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
actions+=/black_arrow,if=!ticking
actions+=/explosive_shot
actions+=/a_murder_of_crows
actions+=/dire_beast
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
actions+=/glaive_toss
actions+=/powershot
actions+=/barrage
# Cast a second shot for steady focus if that won't cap us.
actions+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
actions+=/arcane_shot,if=focus>=80|talent.focusing_shot.enabled
actions+=/focusing_shot
actions+=/cobra_shot

actions.aoe=stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up|buff.archmages_incandescence_agi.up))
actions.aoe+=/explosive_shot,if=buff.lock_and_load.react&(!talent.barrage.enabled|cooldown.barrage.remains>0)
actions.aoe+=/barrage
actions.aoe+=/black_arrow,if=!ticking
actions.aoe+=/explosive_shot,if=active_enemies<5
actions.aoe+=/explosive_trap,if=dot.explosive_trap.remains<=5
actions.aoe+=/a_murder_of_crows
actions.aoe+=/dire_beast
actions.aoe+=/multishot,if=buff.thrill_of_the_hunt.react&focus>50&cast_regen<=focus.deficit|dot.serpent_sting.remains<=5|target.time_to_die<4.5
actions.aoe+=/glaive_toss
actions.aoe+=/powershot
actions.aoe+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&focus+14+cast_regen<80
actions.aoe+=/multishot,if=focus>=70|talent.focusing_shot.enabled
actions.aoe+=/focusing_shot
actions.aoe+=/cobra_shot

head=hood_of_dispassionate_execution,id=113608,bonus_id=566
neck=flechetteriddled_chain,id=113647,bonus_id=566,enchant=75crit
shoulders=gruntslayer_shoulderguards,id=115414
back=cloak_of_creeping_necrosis,id=113657,enchant=gift_of_critical_strike
chest=crackleproof_chestguard,id=116029
shirt=artisan_officers_shirt,id=89195
wrists=bracers_of_the_crying_chorus,id=113826,bonus_id=40
hands=grips_of_vicious_mauling,id=113593
waist=belt_of_imminent_lies,id=113827,bonus_id=566
legs=wayfaring_leggings,id=116189,bonus_id=83/526/536
feet=wayfaring_boots,id=116193,bonus_id=131/525/535
finger1=ceds_chiming_circle,id=109760,bonus_id=524,enchant=30crit
finger2=timeless_solium_band_of_the_assassin,id=118297,enchant=30crit
trinket1=grandiose_plans,id=114549
trinket2=bloodmaws_tooth,id=116289
main_hand=crystalline_branch_of_the_brackenspore,id=113652,enchant=megawatt_filament

# Gear Summary
# gear_agility=2446
# gear_stamina=3130
# gear_crit_rating=1437
# gear_haste_rating=787
# gear_mastery_rating=250
# gear_armor=1224
# gear_multistrike_rating=564
# gear_versatility_rating=258
# gear_avoidance_rating=68
summon_pet=cat

Rosalîîe

Rosalîîe : 24633 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
24633.1 24633.1 6.8 / 0.028% 2156.4 / 8.8% 2455.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.0 10.0 Focus 0.00% 44.1 100.0% 100%
Origin http://eu.battle.net/wow/en/character/die-nachtwache/Rosalîîe/advanced
Talents
  • 15: Posthaste
  • 30: Binding Shot
  • 45: Iron Hawk
  • 60: Steady Focus
  • 75: A Murder of Crows
  • 90: Barrage
  • 100: Lone Wolf
  • Talent Calculator
Glyphs
  • Glyph of Deterrence
  • Glyph of Black Ice
  • Glyph of Liberation
  • Glyph of Aspect of the Cheetah
Professions
  • engineering: 686
  • enchanting: 700

Charts

http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:94367|88431|27204|22484|15495|5487|2940&chds=0,188734&chco=C79C6E,9482C9,C41F3B,C79C6E,69CCF0,ABD473,C79C6E&chm=t++94367++a_murder_of_crows,C79C6E,0,0,15|t++88431++black_arrow,9482C9,1,0,15|t++27204++explosive_shot,C41F3B,2,0,15|t++22484++barrage,C79C6E,3,0,15|t++15495++arcane_shot,69CCF0,4,0,15|t++5487++cobra_shot,ABD473,5,0,15|t++2940++auto_shot,C79C6E,6,0,15& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:28,15,12,11,10,10,7,7&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,ABD473,C79C6E,C79C6E,ABD473,C79C6E,69CCF0&chl=explosive_shot|black_arrow|serpent_sting|barrage|auto_shot|cobra_shot|crow_peck|arcane_shot&
http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:Ybejlptxz3478753200zyxvstrpponnnmmnnoooonmmlkjjiiiiiiiijikllnoopppqppppppqpppnonmnmmnmmmlkkjjiihhihiihihhiiijjjjkkjkjjkjkkjkklmmnoooopqqqqqpooommlkkjjjjiiiiijijkkkkjkjjiiiiiiiiiiiijkklmnooopopoppopooonnnmmmmmlmmllkkkjjiiiiiiiiiiiijjjkkllllkllklkkllmmmnnooopqqqqqqppoonmmllkkkjjjjjkjkllllllkkkkjjjjjjjjkjkllmmnooppqqpqqpqpppppooononnnnnnnnmmmlllllllllllmmmnnnnonnljhfdbZXVT&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.648958,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=24633|max=37958&chxp=1,1,65,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:7,4,16,30,52,106,161,242,357,531,658,884,1063,1251,1372,1563,1666,1787,1644,1644,1481,1395,1295,1126,992,748,667,525,439,347,263,191,140,107,89,60,29,23,20,11,4,3,4,1,0,1,0,0,0,1&chds=0,1787&chbh=5&chxt=x&chxl=0:|min=22888|avg=24633|max=27531&chxp=0,1,38,100& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Rosal%C3%AE%C3%AEe+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:46.2,24.9,12.3,10.6,4.2,1.8&chds=0,100&chdls=ffffff&chco=ABD473,C41F3B,C79C6E,69CCF0,9482C9,C79C6E&chl=cobra_shot 138.9s|explosive_shot 75.0s|barrage 37.1s|arcane_shot 31.8s|black_arrow 12.6s|a_murder_of_crows 5.3s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Rosalîîe 24633
a_murder_of_crows 0 (1677) 0.0% (6.8%) 5.3 61.88sec 94789 94367

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.31 5.31 77.74 77.74 1.0045 1.0000 0.00 0.00 0.00 6061.44 94366.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.7 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target over the next {$d=15 seconds}. If the target dies while under attack, A Murder of Crows' cooldown is reset.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    crow_peck 1677 6.8% 0.0 0.00sec 0 0 Direct 77.7 4428 8859 5670 28.0% 36.2 1355 2711 28.0%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 77.74 0.00 0.00 0.0000 0.0000 503541.86 773864.33 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.12 27.96% 2710.87 2456 3057 2711.62 0 3057 27431 42158 34.92
multistrike 26.07 72.04% 1355.34 1228 1528 1355.95 1228 1528 35332 54300 34.93
hit 55.95 71.98% 4428.38 4094 5095 4432.28 4178 4719 247781 380801 34.93
crit 21.78 28.02% 8859.36 8187 10189 8866.44 8187 9903 192997 296606 34.93
 
DPS Timeline Chart
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.170000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
arcane_shot 1642 6.7% 31.7 9.60sec 15565 15495 Direct 31.4 10555 21106 13494 27.9% 14.1 3821 7639 28.0%  

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.67 31.40 0.00 0.00 1.0045 0.0000 492878.87 492878.87 0.00 15495.44 15495.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.96 27.99% 7639.36 7380 8821 7489.23 0 8821 30227 30227 0.00
multistrike 10.18 72.01% 3821.38 3690 4411 3823.77 0 4411 38898 38898 0.00
hit 22.65 72.14% 10554.68 10250 12252 10558.99 10250 11251 239101 239101 0.00
crit 8.75 27.86% 21105.90 20500 24504 21110.31 0 24504 184652 184652 0.00
 
DPS Timeline Chart
 

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:An instant shot that causes $sw2 Arcane damage.$?p131564[ Grants {$142978s1=122} PvP Power for {$142978d=6 seconds}.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.26
 
auto_shot 2546 10.3% 106.5 2.84sec 7185 2940 Direct 106.5 4836 9672 6188 27.9% 47.2 1756 3513 28.0%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.49 106.49 0.00 0.00 2.4435 0.0000 765109.80 1175852.95 34.93 2940.36 2940.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.21 27.97% 3513.22 3373 4037 3515.07 3373 4037 46422 71344 34.93
multistrike 34.03 72.03% 1756.39 1687 2018 1757.33 1687 1883 59777 91867 34.93
hit 76.73 72.06% 4836.20 4685 5607 4838.51 4739 4957 371102 570325 34.93
crit 29.76 27.94% 9672.39 9370 11214 9677.00 9370 10292 287809 442317 34.93
 
DPS Timeline Chart
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
barrage 2773 11.3% 13.3 22.39sec 62883 22484 Periodic 211.7 2488 4977 3185 28.0% 90.4 1382 2764 27.9% 11.2%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.26 13.26 212.24 211.71 2.7968 0.1592 834139.11 1196099.96 30.26 22484.14 22484.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 25.3 27.94% 2763.87 2675 3198 2764.81 2675 3044 69849 69849 0.00
multistrike 65.2 72.06% 1381.81 1338 1599 1382.40 1338 1489 90049 90049 0.00
hit 152.5 72.02% 2488.41 2418 2890 2489.61 2438 2582 379398 583074 34.93
crit 59.2 27.98% 4976.60 4836 5780 4979.01 4836 5283 294843 453127 34.93
 
DPS Timeline Chart
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the enemy target and an average of $<damageSec> Physical damage to each other enemy target in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.69
 
black_arrow 3709 15.1% 12.6 24.87sec 88826 88431 Periodic 121.2 6188 12374 7920 28.0% 53.9 2249 4499 28.0% 80.6%

Stats details: black_arrow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.56 12.54 121.21 121.21 1.0045 2.0000 1115292.21 1115292.21 0.00 4373.06 88431.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.04 72.06% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.50 27.94% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 15.1 28.00% 4498.79 4292 5342 4501.77 4292 5192 67936 67936 0.00
multistrike 38.8 72.00% 2248.80 2146 2671 2250.39 2146 2436 87302 87302 0.00
hit 87.3 72.00% 6188.37 5962 7419 6192.13 6056 6372 540062 540062 0.00
crit 33.9 28.00% 12373.65 11923 14838 12381.15 11923 13381 419991 419991 0.00
 
DPS Timeline Chart
 

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:3674
  • name:Black Arrow
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.566720
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cobra_shot 2535 10.3% 81.4 3.62sec 9364 5487 Direct 81.2 6324 12645 8093 28.0% 35.7 2293 4586 28.0%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.41 81.24 0.00 0.00 1.7066 0.0000 762360.86 762360.86 0.00 5487.26 5487.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.02 28.03% 4585.89 4428 5293 4588.12 0 5293 45928 45928 0.00
multistrike 25.71 71.97% 2293.46 2214 2646 2294.75 2214 2502 58962 58962 0.00
hit 58.50 72.01% 6323.57 6150 7351 6326.37 6173 6542 369944 369944 0.00
crit 22.74 27.99% 12645.41 12300 14702 12651.17 12300 13572 287526 287526 0.00
 
DPS Timeline Chart
 

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:
  • description:Deals $sw2 Nature damage and generates {$91954s1=14} Focus. Usable while moving.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.76
 
explosive_shot 6785 27.5% 74.7 4.03sec 27326 27204 Direct 74.4 4643 9286 5942 28.0% 33.4 1689 3376 28.0%  
Periodic 168.3 6107 12210 7815 28.0% 74.6 2207 4417 28.0% 55.9%

Stats details: explosive_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.65 74.43 168.25 168.25 1.0045 1.0000 2040031.78 2040031.78 0.00 8386.81 27204.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.36 27.99% 3375.80 3219 4006 3377.60 0 4006 31594 31594 0.00
multistrike 24.07 72.01% 1688.64 1610 2003 1689.66 1610 1919 40650 40650 0.00
hit 53.62 72.04% 4643.39 4471 5564 4646.22 4491 4895 248965 248965 0.00
crit 20.81 27.96% 9286.45 8943 11129 9292.28 8943 10218 193269 193269 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 20.9 28.00% 4417.20 3220 11596 4413.57 3220 6452 92207 92207 0.00
multistrike 53.7 72.00% 2207.44 1610 5938 2206.28 1799 3075 118514 118514 0.00
hit 121.2 72.02% 6107.10 4472 16495 6107.02 5441 7341 740048 740048 0.00
crit 47.1 27.98% 12210.35 8943 33090 12209.04 10188 15919 574784 574784 0.00
 
DPS Timeline Chart
 

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.552552
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 

Action details: explosive_shot_tick

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${$<explosive>} Fire damage initially and every second for {$d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
serpent_sting 2966 12.0% 31.4 9.65sec 28394 0 Periodic 129.7 4628 9257 5922 28.0% 57.0 1690 3380 28.0% 98.0%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.40 31.40 129.72 129.72 0.0000 2.2738 891642.33 891642.33 0.00 3022.85 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.61 72.00% 0.00 0 0 0.00 0 0 0 0 0.00
crit 8.79 28.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 16.0 27.98% 3380.49 3250 4045 3382.75 3250 3846 53958 53958 0.00
multistrike 41.1 72.02% 1689.88 1625 2022 1690.99 1625 1836 69416 69416 0.00
hit 93.5 72.04% 4628.36 0 5618 4630.97 4438 4804 432561 432561 0.00
crit 36.3 27.96% 9256.74 3 11235 9261.78 8374 9931 335707 335707 0.00
 
DPS Timeline Chart
 

Action details: serpent_sting

Static Values
  • id:118253
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118253
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes $o1 Nature damage over {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.725402
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Rosalîîe
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
balanced_fate 5.7 0.0 51.2sec 50.6sec 18.62% 18.63% 0.0(0.0)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_balanced_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:2004.00

Stack Uptimes

  • balanced_fate_1:18.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177038
  • name:Balanced Fate
  • tooltip:Increases Multistrike by {$s1=1135}.
  • description:Increases Multistrike by {$s1=1135} for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 42.86% 0.0(0.0)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_agility_potion 2.0 0.0 191.5sec 0.0sec 15.05% 15.06% 0.0(0.0)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lock_and_load 14.9 0.2 19.9sec 19.6sec 9.17% 39.92% 0.2(0.3)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lock_and_load_1:5.00%
  • lock_and_load_2:4.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:168980
  • name:Lock and Load
  • tooltip:Your Explosive Shot triggers no cooldown.
  • description:{$@spelldesc3674=Fires a Black Arrow at the target, dealing $3674o1 damage over {$3674d=20 seconds}. Your Black Arrow periodic damage has a {$s2=20}% chance to trigger Lock and Load, causing your next two Explosive Shots to cost no Focus and trigger no cooldown. When Black Arrow is dispelled, its cooldown is reset.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
oglethorpes_missile_splitter 7.2 2.4 43.8sec 31.6sec 32.83% 32.84% 2.4(2.4)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_oglethorpes_missile_splitter
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:750.00

Stack Uptimes

  • oglethorpes_missile_splitter_1:32.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156055
  • name:Oglethorpe's Missile Splitter
  • tooltip:Multistrike increased by $w1.
  • description:Multistrike increased by {$s1=750}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
steady_focus 13.7 10.1 21.9sec 12.4sec 70.14% 74.50% 10.1(10.1)

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • steady_focus_1:70.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177668
  • name:Steady Focus
  • tooltip:Focus regeneration increased by $w1%.
  • description:{$@spelldesc177667=Using {$?s163485=false}[Focusing Shot]?s77767[Cobra Shot twice in a row][Steady Shot twice in a row] increases your Focus Regeneration by {$177668s1=50}% for {$177668d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Rosalîîe
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rosalîîe
a_murder_of_crows Focus 5.3 159.4 30.0 30.0 3159.7
arcane_shot Focus 31.7 950.0 30.0 30.0 518.8
barrage Focus 13.3 795.9 60.0 60.0 1048.0
black_arrow Focus 12.6 439.5 35.0 35.0 2537.9
explosive_shot Focus 74.7 671.2 9.0 9.0 3039.2
Resource Gains Type Count Total Average Overflow
focus_regen Focus 218.32 1348.49 (45.90%) 6.18 66.05 4.67%
external_healing Health 7.93 0.00 (0.00%) 0.00 74095.44 100.00%
steady_focus Focus 162.63 476.15 (16.21%) 2.93 50.97 9.67%
cobra_shot Focus 81.24 1113.55 (37.90%) 13.71 23.81 2.09%
Resource RPS-Gain RPS-Loss
Focus 9.76 10.02
Combat End Resource Mean Min Max
Focus 21.96 0.01 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 2.0%
cat-Focus Cap 2.0%
devilsaur-Focus Cap 2.0%
raptor-Focus Cap 2.0%
hyena-Focus Cap 2.0%
wolf-Focus Cap 2.0%
wasp-Focus Cap 2.0%
t17_pet_2-Focus Cap 2.0%
t17_pet_1-Focus Cap 2.0%
dire_beast_1-Focus Cap 2.0%
dire_beast_2-Focus Cap 2.0%
tier15_thunderhawk-Focus Cap 2.0%
tier15_thunderhawk-Focus Cap 2.0%
tier15_thunderhawk-Focus Cap 2.0%
tier15_thunderhawk-Focus Cap 2.0%
tier15_thunderhawk-Focus Cap 2.0%
tier15_thunderhawk-Focus Cap 2.0%
tier15_thunderhawk-Focus Cap 2.0%
tier15_thunderhawk-Focus Cap 2.0%
tier15_thunderhawk-Focus Cap 2.0%
tier15_thunderhawk-Focus Cap 2.0%

Procs

Count Interval
starved: black_arrow 0.7 17.4sec
starved: explosive_shot 0.2 64.7sec
starved: a_murder_of_crows 0.6 25.0sec
starved: barrage 7.4 34.8sec
lock_and_load 15.1 19.6sec

Statistics & Data Analysis

Fight Length
Sample Data Rosalîîe Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Rosalîîe Damage Per Second
Count 25000
Mean 24633.09
Minimum 22888.26
Maximum 27530.83
Spread ( max - min ) 4642.57
Range [ ( max - min ) / 2 * 100% ] 9.42%
Standard Deviation 551.2397
5th Percentile 23773.54
95th Percentile 25589.10
( 95th Percentile - 5th Percentile ) 1815.57
Mean Distribution
Standard Deviation 3.4863
95.00% Confidence Intervall ( 24626.25 - 24639.92 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1923
0.1 Scale Factor Error with Delta=300 2593
0.05 Scale Factor Error with Delta=300 10375
0.01 Scale Factor Error with Delta=300 259396
Distribution Chart
DPS(e)
Sample Data Rosalîîe Damage Per Second (Effective)
Count 25000
Mean 24633.09
Minimum 22888.26
Maximum 27530.83
Spread ( max - min ) 4642.57
Range [ ( max - min ) / 2 * 100% ] 9.42%
Damage
Sample Data Rosalîîe Damage
Count 25000
Mean 7404996.81
Minimum 5388565.37
Maximum 9541850.29
Spread ( max - min ) 4153284.92
Range [ ( max - min ) / 2 * 100% ] 28.04%
DTPS
Sample Data Rosalîîe Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rosalîîe Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Rosalîîe Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rosalîîe Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rosalîîe Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rosalîîe Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data RosalîîeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Rosalîîe Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 exotic_munitions,ammo_type=poisoned,if=active_enemies<3
5 0.00 exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
6 0.00 potion,name=draenic_agility
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
8 0.00 use_item,name=belt_of_imminent_lies
9 0.00 arcane_torrent,if=focus.deficit>=30
A 0.00 blood_fury
B 0.00 berserking
C 1.00 potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
D 0.00 call_action_list,name=aoe,if=active_enemies>1
E 0.00 stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
F 12.56 black_arrow,if=!ticking
G 74.66 explosive_shot
H 5.31 a_murder_of_crows
I 0.00 dire_beast
J 11.23 arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
K 0.00 glaive_toss
L 0.00 powershot
M 13.26 barrage
N 25.01 cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
Cast a second shot for steady focus if that won't cap us.
O 20.44 arcane_shot,if=focus>=80|talent.focusing_shot.enabled
P 0.00 focusing_shot
Q 56.86 cobra_shot

Sample Sequence

0167FGHJQNQGGGGMQNJGGGGQNFOQGOQNMGGGGQNOOQGGGGFQNMGQNCJHGQQGGGOQFMGQNQGGGOQNOGOQMFGQNQGQOGGGOQNMGQFHQGQNJGGGOQMGGGGGQFQNGGGGGGJMQGQNQGOFQNGGGMQHGJQNQGOQFQGGGGMQNGQJQNGOQFQGMQNGQNOOGQGGGOQFHQGQNMGQNGGGJQNOFGQQMGQGGGJJJQN

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 100.0/100: 100% focus
Pre food Fluffy_Pillow 100.0/100: 100% focus
Pre potion Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 start_auto_shot Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:00.000 black_arrow Fluffy_Pillow 100.0/100: 100% focus draenic_agility_potion
0:01.005 explosive_shot Fluffy_Pillow 70.9/100: 71% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:02.011 a_murder_of_crows Fluffy_Pillow 61.8/100: 62% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:03.017 arcane_shot Fluffy_Pillow 37.8/100: 38% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:04.022 cobra_shot Fluffy_Pillow 13.7/100: 14% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:05.385 cobra_shot Fluffy_Pillow 21.7/100: 22% focus bloodlust, oglethorpes_missile_splitter, draenic_agility_potion
0:06.748 cobra_shot Fluffy_Pillow 47.7/100: 48% focus bloodlust, steady_focus, oglethorpes_missile_splitter, draenic_agility_potion
0:08.112 explosive_shot Fluffy_Pillow 73.8/100: 74% focus bloodlust, steady_focus, oglethorpes_missile_splitter, draenic_agility_potion
0:09.117 explosive_shot Fluffy_Pillow 81.7/100: 82% focus bloodlust, steady_focus, lock_and_load(2), oglethorpes_missile_splitter, draenic_agility_potion
0:10.122 explosive_shot Fluffy_Pillow 90.5/100: 91% focus bloodlust, steady_focus, lock_and_load, oglethorpes_missile_splitter, draenic_agility_potion
0:11.127 explosive_shot Fluffy_Pillow 99.4/100: 99% focus bloodlust, steady_focus, oglethorpes_missile_splitter, draenic_agility_potion
0:12.131 barrage Fluffy_Pillow 93.3/100: 93% focus bloodlust, steady_focus, draenic_agility_potion
0:14.338 cobra_shot Fluffy_Pillow 52.8/100: 53% focus bloodlust, steady_focus, draenic_agility_potion
0:15.701 cobra_shot Fluffy_Pillow 64.8/100: 65% focus bloodlust, steady_focus, balanced_fate, draenic_agility_potion
0:17.063 arcane_shot Fluffy_Pillow 86.8/100: 87% focus bloodlust, balanced_fate, draenic_agility_potion
0:18.070 explosive_shot Fluffy_Pillow 76.8/100: 77% focus bloodlust, balanced_fate, draenic_agility_potion
0:19.075 explosive_shot Fluffy_Pillow 67.7/100: 68% focus bloodlust, lock_and_load(2), balanced_fate, draenic_agility_potion
0:20.079 explosive_shot Fluffy_Pillow 73.6/100: 74% focus bloodlust, lock_and_load, balanced_fate
0:21.084 explosive_shot Fluffy_Pillow 79.5/100: 80% focus bloodlust, balanced_fate
0:22.089 cobra_shot Fluffy_Pillow 70.4/100: 70% focus bloodlust, balanced_fate
0:23.451 cobra_shot Fluffy_Pillow 78.4/100: 78% focus bloodlust, balanced_fate
0:24.813 black_arrow Fluffy_Pillow 100.0/100: 100% focus bloodlust, steady_focus, balanced_fate
0:25.818 arcane_shot Fluffy_Pillow 87.9/100: 88% focus bloodlust, steady_focus
0:26.822 cobra_shot Fluffy_Pillow 66.7/100: 67% focus bloodlust, steady_focus
0:28.185 explosive_shot Fluffy_Pillow 78.8/100: 79% focus bloodlust, steady_focus
0:29.189 arcane_shot Fluffy_Pillow 86.6/100: 87% focus bloodlust, steady_focus
0:30.195 cobra_shot Fluffy_Pillow 65.5/100: 66% focus bloodlust, steady_focus
0:31.558 cobra_shot Fluffy_Pillow 77.6/100: 78% focus bloodlust, steady_focus
0:32.919 barrage Fluffy_Pillow 100.0/100: 100% focus bloodlust, steady_focus
0:35.214 explosive_shot Fluffy_Pillow 74.3/100: 74% focus bloodlust, steady_focus
0:36.218 explosive_shot Fluffy_Pillow 68.1/100: 68% focus bloodlust, steady_focus, lock_and_load(2)
0:37.222 explosive_shot Fluffy_Pillow 77.0/100: 77% focus bloodlust, steady_focus, lock_and_load
0:38.228 explosive_shot Fluffy_Pillow 85.9/100: 86% focus bloodlust, steady_focus
0:39.233 cobra_shot Fluffy_Pillow 79.8/100: 80% focus bloodlust, steady_focus
0:40.595 cobra_shot Fluffy_Pillow 91.8/100: 92% focus bloodlust, steady_focus
0:41.957 arcane_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus
0:42.962 arcane_shot Fluffy_Pillow 90.8/100: 91% focus steady_focus
0:43.967 cobra_shot Fluffy_Pillow 67.7/100: 68% focus steady_focus
0:45.738 explosive_shot Fluffy_Pillow 79.7/100: 80% focus steady_focus
0:46.744 explosive_shot Fluffy_Pillow 85.5/100: 86% focus steady_focus, lock_and_load(2)
0:47.749 explosive_shot Fluffy_Pillow 92.3/100: 92% focus steady_focus, lock_and_load
0:48.752 explosive_shot Fluffy_Pillow 99.2/100: 99% focus steady_focus
0:49.757 black_arrow Fluffy_Pillow 91.0/100: 91% focus steady_focus, balanced_fate
0:50.761 cobra_shot Fluffy_Pillow 62.8/100: 63% focus steady_focus, balanced_fate
0:52.531 cobra_shot Fluffy_Pillow 70.8/100: 71% focus balanced_fate
0:54.300 barrage Fluffy_Pillow 96.8/100: 97% focus steady_focus, balanced_fate
0:57.210 explosive_shot Fluffy_Pillow 70.6/100: 71% focus steady_focus, balanced_fate
0:58.214 cobra_shot Fluffy_Pillow 62.4/100: 62% focus steady_focus, balanced_fate
0:59.985 cobra_shot Fluffy_Pillow 74.5/100: 74% focus steady_focus, balanced_fate
1:01.754 potion Fluffy_Pillow 100.0/100: 100% focus steady_focus, balanced_fate
1:01.754 arcane_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus, balanced_fate, draenic_agility_potion
1:02.758 a_murder_of_crows Fluffy_Pillow 90.8/100: 91% focus steady_focus, balanced_fate, draenic_agility_potion
1:03.762 explosive_shot Fluffy_Pillow 67.6/100: 68% focus steady_focus, balanced_fate, draenic_agility_potion
1:04.767 cobra_shot Fluffy_Pillow 59.5/100: 59% focus steady_focus, balanced_fate, draenic_agility_potion
1:06.536 cobra_shot Fluffy_Pillow 71.5/100: 71% focus steady_focus, balanced_fate, draenic_agility_potion
1:08.305 explosive_shot Fluffy_Pillow 97.5/100: 98% focus steady_focus, lock_and_load(2), balanced_fate, draenic_agility_potion
1:09.310 explosive_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus, lock_and_load, balanced_fate, draenic_agility_potion
1:10.313 explosive_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus, draenic_agility_potion
1:11.317 arcane_shot Fluffy_Pillow 91.8/100: 92% focus steady_focus, draenic_agility_potion
1:12.322 cobra_shot Fluffy_Pillow 68.6/100: 69% focus steady_focus, draenic_agility_potion
1:14.093 black_arrow Fluffy_Pillow 80.7/100: 81% focus steady_focus, draenic_agility_potion
1:15.099 barrage Fluffy_Pillow 66.5/100: 67% focus steady_focus, draenic_agility_potion
1:18.053 explosive_shot Fluffy_Pillow 26.6/100: 27% focus steady_focus, oglethorpes_missile_splitter, draenic_agility_potion
1:19.057 cobra_shot Fluffy_Pillow 16.1/100: 16% focus oglethorpes_missile_splitter, draenic_agility_potion
1:20.827 cobra_shot Fluffy_Pillow 24.1/100: 24% focus oglethorpes_missile_splitter, draenic_agility_potion
1:22.599 cobra_shot Fluffy_Pillow 50.2/100: 50% focus steady_focus, oglethorpes_missile_splitter, draenic_agility_potion
1:24.369 explosive_shot Fluffy_Pillow 76.2/100: 76% focus steady_focus, lock_and_load(2), oglethorpes_missile_splitter, draenic_agility_potion
1:25.373 explosive_shot Fluffy_Pillow 97.0/100: 97% focus steady_focus, lock_and_load, oglethorpes_missile_splitter, draenic_agility_potion
1:26.377 explosive_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus, oglethorpes_missile_splitter, draenic_agility_potion
1:27.381 arcane_shot Fluffy_Pillow 91.8/100: 92% focus steady_focus, oglethorpes_missile_splitter
1:28.386 cobra_shot Fluffy_Pillow 68.6/100: 69% focus steady_focus, oglethorpes_missile_splitter
1:30.156 cobra_shot Fluffy_Pillow 80.7/100: 81% focus steady_focus, oglethorpes_missile_splitter
1:31.927 arcane_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus, oglethorpes_missile_splitter
1:32.931 explosive_shot Fluffy_Pillow 90.8/100: 91% focus steady_focus, oglethorpes_missile_splitter
1:33.936 arcane_shot Fluffy_Pillow 82.6/100: 83% focus steady_focus, oglethorpes_missile_splitter
1:34.941 cobra_shot Fluffy_Pillow 59.5/100: 59% focus steady_focus, oglethorpes_missile_splitter
1:36.712 barrage Fluffy_Pillow 71.5/100: 72% focus steady_focus, oglethorpes_missile_splitter
1:39.635 black_arrow Fluffy_Pillow 45.4/100: 45% focus steady_focus
1:40.639 explosive_shot Fluffy_Pillow 17.2/100: 17% focus steady_focus
1:41.643 cobra_shot Fluffy_Pillow 9.0/100: 9% focus steady_focus
1:43.414 cobra_shot Fluffy_Pillow 17.0/100: 17% focus
1:45.184 cobra_shot Fluffy_Pillow 43.0/100: 43% focus steady_focus
1:46.955 explosive_shot Fluffy_Pillow 69.1/100: 69% focus steady_focus
1:47.960 cobra_shot Fluffy_Pillow 74.9/100: 75% focus steady_focus
1:49.731 arcane_shot Fluffy_Pillow 86.9/100: 87% focus steady_focus
1:50.735 explosive_shot Fluffy_Pillow 77.8/100: 78% focus steady_focus, lock_and_load(2)
1:51.741 explosive_shot Fluffy_Pillow 84.6/100: 85% focus steady_focus, lock_and_load
1:52.745 explosive_shot Fluffy_Pillow 91.4/100: 91% focus steady_focus
1:53.750 arcane_shot Fluffy_Pillow 83.2/100: 83% focus steady_focus
1:54.755 cobra_shot Fluffy_Pillow 60.1/100: 60% focus steady_focus
1:56.525 cobra_shot Fluffy_Pillow 68.1/100: 68% focus
1:58.298 barrage Fluffy_Pillow 94.1/100: 94% focus steady_focus, oglethorpes_missile_splitter
2:01.195 explosive_shot Fluffy_Pillow 67.8/100: 68% focus steady_focus, oglethorpes_missile_splitter
2:02.200 cobra_shot Fluffy_Pillow 59.6/100: 60% focus steady_focus, oglethorpes_missile_splitter
2:03.971 black_arrow Fluffy_Pillow 71.7/100: 72% focus steady_focus, oglethorpes_missile_splitter
2:04.975 a_murder_of_crows Fluffy_Pillow 57.5/100: 57% focus steady_focus, oglethorpes_missile_splitter
2:05.981 cobra_shot Fluffy_Pillow 34.3/100: 34% focus steady_focus, oglethorpes_missile_splitter
2:07.751 explosive_shot Fluffy_Pillow 46.3/100: 46% focus steady_focus, oglethorpes_missile_splitter
2:08.755 cobra_shot Fluffy_Pillow 49.9/100: 50% focus oglethorpes_missile_splitter
2:10.525 cobra_shot Fluffy_Pillow 57.9/100: 58% focus
2:12.296 arcane_shot Fluffy_Pillow 83.9/100: 84% focus steady_focus
2:13.302 explosive_shot Fluffy_Pillow 74.8/100: 75% focus steady_focus, lock_and_load(2)
2:14.307 explosive_shot Fluffy_Pillow 81.6/100: 82% focus steady_focus, lock_and_load
2:15.312 explosive_shot Fluffy_Pillow 88.4/100: 88% focus steady_focus, balanced_fate
2:16.317 arcane_shot Fluffy_Pillow 80.3/100: 80% focus steady_focus, balanced_fate
2:17.321 cobra_shot Fluffy_Pillow 57.1/100: 57% focus steady_focus, balanced_fate
2:19.091 barrage Fluffy_Pillow 69.1/100: 69% focus steady_focus, balanced_fate
2:21.950 explosive_shot Fluffy_Pillow 42.5/100: 43% focus steady_focus, lock_and_load(2), balanced_fate
2:22.954 explosive_shot Fluffy_Pillow 47.1/100: 47% focus lock_and_load, balanced_fate
2:23.959 explosive_shot Fluffy_Pillow 51.6/100: 52% focus lock_and_load(2), balanced_fate
2:24.964 explosive_shot Fluffy_Pillow 56.2/100: 56% focus lock_and_load
2:25.968 explosive_shot Fluffy_Pillow 60.7/100: 61% focus
2:26.972 cobra_shot Fluffy_Pillow 50.3/100: 50% focus oglethorpes_missile_splitter
2:28.743 black_arrow Fluffy_Pillow 58.3/100: 58% focus oglethorpes_missile_splitter
2:29.748 cobra_shot Fluffy_Pillow 41.8/100: 42% focus oglethorpes_missile_splitter
2:31.520 cobra_shot Fluffy_Pillow 49.9/100: 50% focus oglethorpes_missile_splitter
2:33.293 explosive_shot Fluffy_Pillow 75.9/100: 76% focus steady_focus, oglethorpes_missile_splitter
2:34.297 explosive_shot Fluffy_Pillow 81.7/100: 82% focus steady_focus, lock_and_load(2), oglethorpes_missile_splitter
2:35.301 explosive_shot Fluffy_Pillow 88.5/100: 89% focus steady_focus, lock_and_load, oglethorpes_missile_splitter
2:36.305 explosive_shot Fluffy_Pillow 95.4/100: 95% focus steady_focus, lock_and_load(2), oglethorpes_missile_splitter
2:37.310 explosive_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus, lock_and_load, oglethorpes_missile_splitter
2:38.315 explosive_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus, oglethorpes_missile_splitter
2:39.320 arcane_shot Fluffy_Pillow 91.8/100: 92% focus steady_focus, oglethorpes_missile_splitter
2:40.323 barrage Fluffy_Pillow 68.6/100: 69% focus steady_focus, oglethorpes_missile_splitter
2:43.168 cobra_shot Fluffy_Pillow 28.0/100: 28% focus steady_focus, oglethorpes_missile_splitter
2:44.939 explosive_shot Fluffy_Pillow 36.0/100: 36% focus
2:45.944 cobra_shot Fluffy_Pillow 39.5/100: 40% focus
2:47.714 cobra_shot Fluffy_Pillow 47.6/100: 48% focus balanced_fate
2:49.485 cobra_shot Fluffy_Pillow 73.6/100: 74% focus steady_focus, balanced_fate
2:51.252 explosive_shot Fluffy_Pillow 99.6/100: 100% focus steady_focus, balanced_fate
2:52.257 arcane_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus, balanced_fate
2:53.262 black_arrow Fluffy_Pillow 76.8/100: 77% focus steady_focus, balanced_fate
2:54.265 cobra_shot Fluffy_Pillow 48.6/100: 49% focus steady_focus, balanced_fate
2:56.036 cobra_shot Fluffy_Pillow 60.7/100: 61% focus steady_focus, balanced_fate
2:57.806 explosive_shot Fluffy_Pillow 86.7/100: 87% focus steady_focus, lock_and_load(2)
2:58.811 explosive_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus, lock_and_load
2:59.814 explosive_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus
3:00.818 barrage Fluffy_Pillow 91.8/100: 92% focus steady_focus
3:03.622 cobra_shot Fluffy_Pillow 50.9/100: 51% focus steady_focus
3:05.394 a_murder_of_crows Fluffy_Pillow 62.9/100: 63% focus steady_focus
3:06.398 explosive_shot Fluffy_Pillow 53.7/100: 54% focus steady_focus
3:07.404 arcane_shot Fluffy_Pillow 45.6/100: 46% focus steady_focus
3:08.409 cobra_shot Fluffy_Pillow 20.1/100: 20% focus
3:10.180 cobra_shot Fluffy_Pillow 28.1/100: 28% focus
3:11.950 cobra_shot Fluffy_Pillow 54.2/100: 54% focus steady_focus
3:13.722 explosive_shot Fluffy_Pillow 80.2/100: 80% focus steady_focus
3:14.727 arcane_shot Fluffy_Pillow 86.0/100: 86% focus steady_focus
3:15.731 cobra_shot Fluffy_Pillow 62.8/100: 63% focus steady_focus
3:17.500 black_arrow Fluffy_Pillow 74.9/100: 75% focus steady_focus
3:18.504 cobra_shot Fluffy_Pillow 60.7/100: 61% focus steady_focus
3:20.274 explosive_shot Fluffy_Pillow 72.7/100: 73% focus steady_focus
3:21.278 explosive_shot Fluffy_Pillow 78.5/100: 79% focus steady_focus, lock_and_load(2)
3:22.282 explosive_shot Fluffy_Pillow 83.1/100: 83% focus lock_and_load
3:23.287 explosive_shot Fluffy_Pillow 87.6/100: 88% focus
3:24.290 barrage Fluffy_Pillow 77.2/100: 77% focus
3:27.136 cobra_shot Fluffy_Pillow 30.1/100: 30% focus
3:28.906 cobra_shot Fluffy_Pillow 38.1/100: 38% focus
3:30.678 explosive_shot Fluffy_Pillow 60.1/100: 60% focus
3:31.683 cobra_shot Fluffy_Pillow 63.6/100: 64% focus
3:33.454 arcane_shot Fluffy_Pillow 71.7/100: 72% focus
3:34.458 cobra_shot Fluffy_Pillow 60.2/100: 60% focus
3:36.229 cobra_shot Fluffy_Pillow 68.2/100: 68% focus
3:38.000 explosive_shot Fluffy_Pillow 94.3/100: 94% focus steady_focus
3:39.005 arcane_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus
3:40.010 cobra_shot Fluffy_Pillow 76.8/100: 77% focus steady_focus
3:41.779 black_arrow Fluffy_Pillow 88.8/100: 89% focus steady_focus
3:42.783 cobra_shot Fluffy_Pillow 74.7/100: 75% focus steady_focus
3:44.552 explosive_shot Fluffy_Pillow 86.7/100: 87% focus steady_focus
3:45.556 barrage Fluffy_Pillow 92.5/100: 93% focus steady_focus
3:48.322 cobra_shot Fluffy_Pillow 45.0/100: 45% focus
3:50.093 cobra_shot Fluffy_Pillow 53.1/100: 53% focus oglethorpes_missile_splitter
3:51.864 explosive_shot Fluffy_Pillow 75.1/100: 75% focus oglethorpes_missile_splitter
3:52.868 cobra_shot Fluffy_Pillow 78.6/100: 79% focus oglethorpes_missile_splitter
3:54.640 cobra_shot Fluffy_Pillow 86.6/100: 87% focus oglethorpes_missile_splitter
3:56.412 arcane_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus, oglethorpes_missile_splitter
3:57.417 arcane_shot Fluffy_Pillow 90.8/100: 91% focus steady_focus, oglethorpes_missile_splitter
3:58.422 explosive_shot Fluffy_Pillow 67.7/100: 68% focus steady_focus, oglethorpes_missile_splitter
3:59.426 cobra_shot Fluffy_Pillow 59.5/100: 59% focus steady_focus, oglethorpes_missile_splitter
4:01.196 explosive_shot Fluffy_Pillow 71.5/100: 71% focus steady_focus, lock_and_load(2), oglethorpes_missile_splitter
4:02.201 explosive_shot Fluffy_Pillow 92.3/100: 92% focus steady_focus, lock_and_load
4:03.206 explosive_shot Fluffy_Pillow 99.2/100: 99% focus steady_focus
4:04.212 arcane_shot Fluffy_Pillow 91.0/100: 91% focus steady_focus
4:05.216 cobra_shot Fluffy_Pillow 67.8/100: 68% focus steady_focus
4:06.988 black_arrow Fluffy_Pillow 75.8/100: 76% focus
4:07.993 a_murder_of_crows Fluffy_Pillow 59.4/100: 59% focus
4:08.999 cobra_shot Fluffy_Pillow 33.9/100: 34% focus
4:10.768 explosive_shot Fluffy_Pillow 42.0/100: 42% focus
4:11.772 cobra_shot Fluffy_Pillow 45.5/100: 45% focus
4:13.543 cobra_shot Fluffy_Pillow 53.5/100: 54% focus
4:15.314 barrage Fluffy_Pillow 79.6/100: 80% focus steady_focus
4:18.142 explosive_shot Fluffy_Pillow 52.8/100: 53% focus steady_focus
4:19.145 cobra_shot Fluffy_Pillow 44.6/100: 45% focus steady_focus
4:20.913 cobra_shot Fluffy_Pillow 56.6/100: 57% focus steady_focus
4:22.682 explosive_shot Fluffy_Pillow 82.6/100: 83% focus steady_focus, lock_and_load(2), balanced_fate
4:23.686 explosive_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus, lock_and_load, balanced_fate
4:24.691 explosive_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus, balanced_fate
4:25.696 arcane_shot Fluffy_Pillow 91.8/100: 92% focus steady_focus, balanced_fate
4:26.703 cobra_shot Fluffy_Pillow 68.7/100: 69% focus steady_focus, balanced_fate
4:28.473 cobra_shot Fluffy_Pillow 80.7/100: 81% focus steady_focus, balanced_fate
4:30.243 arcane_shot Fluffy_Pillow 100.0/100: 100% focus steady_focus, balanced_fate, oglethorpes_missile_splitter
4:31.247 black_arrow Fluffy_Pillow 90.8/100: 91% focus steady_focus, balanced_fate, oglethorpes_missile_splitter
4:32.252 explosive_shot Fluffy_Pillow 62.6/100: 63% focus steady_focus, oglethorpes_missile_splitter
4:33.258 cobra_shot Fluffy_Pillow 54.5/100: 54% focus steady_focus, oglethorpes_missile_splitter
4:35.030 cobra_shot Fluffy_Pillow 66.5/100: 67% focus steady_focus, oglethorpes_missile_splitter
4:36.800 barrage Fluffy_Pillow 92.5/100: 93% focus steady_focus, oglethorpes_missile_splitter
4:39.715 explosive_shot Fluffy_Pillow 66.3/100: 66% focus steady_focus, oglethorpes_missile_splitter
4:40.720 cobra_shot Fluffy_Pillow 58.2/100: 58% focus steady_focus, oglethorpes_missile_splitter
4:42.491 explosive_shot Fluffy_Pillow 70.2/100: 70% focus steady_focus, lock_and_load(2)
4:43.495 explosive_shot Fluffy_Pillow 91.0/100: 91% focus steady_focus, lock_and_load
4:44.501 explosive_shot Fluffy_Pillow 97.9/100: 98% focus steady_focus
4:45.506 arcane_shot Fluffy_Pillow 89.7/100: 90% focus steady_focus
4:46.512 arcane_shot Fluffy_Pillow 66.5/100: 67% focus steady_focus
4:47.516 arcane_shot Fluffy_Pillow 41.1/100: 41% focus
4:48.520 cobra_shot Fluffy_Pillow 15.6/100: 16% focus
4:50.292 cobra_shot Fluffy_Pillow 23.6/100: 24% focus

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 930 886 886
Agility 4510 4034 3906 (1460)
Stamina 4504 4095 4095
Intellect 895 853 853
Spirit 713 713 713
Health 270240 245700 0
Focus 100 100 0
Crit 30.98% 24.16% 1008
Haste 13.22% 7.83% 783
Multistrike 12.39% 7.39% 488
Damage / Heal Versatility 8.37% 5.37% 698
Attack Power 4961 4034 0
Mastery 15.74% 10.74% 301
Armor 1260 1260 1260
Run Speed 0 0 90

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimaera
30 Binding Shot Wyvern Sting Intimidation
45 Exhilaration Iron Hawk Spirit Bond
60 Steady Focus Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strikes Stampede
90 Glaive Toss Powershot Barrage
100 Exotic Munitions Focusing Shot (Survival Hunter) Lone Wolf

Profile

hunter="Rosalîîe"
origin="http://eu.battle.net/wow/en/character/die-nachtwache/Rosalîîe/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/37/85695781-avatar.jpg"
level=100
race=pandaren_alliance
role=attack
position=ranged_back
professions=engineering=686/enchanting=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Yb!0010022
glyphs=deterrence/black_ice/liberation/aspect_of_the_cheetah
spec=survival

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/exotic_munitions,ammo_type=poisoned,if=active_enemies<3
actions.precombat+=/exotic_munitions,ammo_type=incendiary,if=active_enemies>=3
actions.precombat+=/potion,name=draenic_agility

# Executed every time the actor is available.

actions=auto_shot
actions+=/use_item,name=belt_of_imminent_lies
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=draenic_agility,if=(((cooldown.stampede.remains<1)&(cooldown.a_murder_of_crows.remains<1))&(trinket.stat.any.up|buff.archmages_greater_incandescence_agi.up))|target.time_to_die<=25
actions+=/call_action_list,name=aoe,if=active_enemies>1
actions+=/stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up))|target.time_to_die<=25
actions+=/black_arrow,if=!ticking
actions+=/explosive_shot
actions+=/a_murder_of_crows
actions+=/dire_beast
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react&focus>35&cast_regen<=focus.deficit|dot.serpent_sting.remains<=3|target.time_to_die<4.5
actions+=/glaive_toss
actions+=/powershot
actions+=/barrage
# Cast a second shot for steady focus if that won't cap us.
actions+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&(14+cast_regen)<=focus.deficit<80
actions+=/arcane_shot,if=focus>=80|talent.focusing_shot.enabled
actions+=/focusing_shot
actions+=/cobra_shot

actions.aoe=stampede,if=buff.potion.up|(cooldown.potion.remains&(buff.archmages_greater_incandescence_agi.up|trinket.stat.any.up|buff.archmages_incandescence_agi.up))
actions.aoe+=/explosive_shot,if=buff.lock_and_load.react&(!talent.barrage.enabled|cooldown.barrage.remains>0)
actions.aoe+=/barrage
actions.aoe+=/black_arrow,if=!ticking
actions.aoe+=/explosive_shot,if=active_enemies<5
actions.aoe+=/explosive_trap,if=dot.explosive_trap.remains<=5
actions.aoe+=/a_murder_of_crows
actions.aoe+=/dire_beast
actions.aoe+=/multishot,if=buff.thrill_of_the_hunt.react&focus>50&cast_regen<=focus.deficit|dot.serpent_sting.remains<=5|target.time_to_die<4.5
actions.aoe+=/glaive_toss
actions.aoe+=/powershot
actions.aoe+=/cobra_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<5&focus+14+cast_regen<80
actions.aoe+=/multishot,if=focus>=70|talent.focusing_shot.enabled
actions.aoe+=/focusing_shot
actions.aoe+=/cobra_shot

head=hood_of_dispassionate_execution,id=113608
neck=earthcallers_charm,id=120083,enchant=75mult
shoulders=living_mountain_shoulderguards,id=113641,bonus_id=42
back=cloak_of_creeping_necrosis,id=113657,bonus_id=563,gems=50mult,enchant=gift_of_multistrike
chest=mosswoven_mailshirt,id=113654,bonus_id=561/566
wrists=bracers_of_the_crying_chorus,id=113826
hands=grips_of_vicious_mauling,id=113593,bonus_id=566
waist=belt_of_imminent_lies,id=113827,bonus_id=560,addon=nitro_boosts
legs=legguards_of_ravenous_assault,id=116032
feet=treads_of_sand_and_blood,id=113595,bonus_id=566
finger1=shifting_taladite_ring,id=115796,bonus_id=234/525/540,enchant=50mult
finger2=timeless_solium_band_of_the_assassin,id=118297,enchant=50mult
trinket1=bloodmaws_tooth,id=116289
trinket2=scales_of_doom,id=113612,bonus_id=566
main_hand=grandiose_longbow,id=115329,bonus_id=490,enchant=oglethorpes_missile_splitter

# Gear Summary
# gear_agility=2560
# gear_stamina=3204
# gear_crit_rating=1008
# gear_haste_rating=783
# gear_mastery_rating=301
# gear_armor=1260
# gear_multistrike_rating=465
# gear_versatility_rating=698
# gear_speed_rating=90
summon_pet=cat

Procrank

Procrank : 25311 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
25311.0 25311.0 11.5 / 0.045% 3539.9 / 14.0% 7.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
2688.2 2688.2 Mana 0.00% 42.4 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Procrank/advanced
Talents
  • 15: Ice Floes
  • 30: Ice Barrier
  • 45: Ring of Frost
  • 60: Cauterize
  • 75: Ice Nova (Frost Mage)
  • 90: Mirror Image
  • 100: Thermal Void (Frost Mage)
  • Talent Calculator
Glyphs
  • Glyph of Icy Veins
  • Glyph of Water Elemental
  • Glyph of Splitting Ice
  • Glyph of the Unbound Elemental
  • Glyph of Illusion
  • Glyph of Rapid Teleportation
Professions
  • inscription: 700
  • tailoring: 643

Charts

http://8.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Procrank+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:380257|37187|36534|34431|21240|11152&chds=0,760515&chco=69CCF0,0070DE,9900CC,0070DE,0070DE,0070DE&chm=t++380257++mirror_image,69CCF0,0,0,15|t++37187++ice_nova,0070DE,1,0,15|t++36534++frostfire_bolt,9900CC,2,0,15|t++34431++frozen_orb,0070DE,3,0,15|t++21240++ice_lance,0070DE,4,0,15|t++11152++frostbolt,0070DE,5,0,15& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Procrank+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:24,23,19,18,11,11,9,7,4,2,2&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,9900CC,0070DE,0070DE,0070DE,0070DE,9900CC,0070DE,C79C6E,0070DE&chl=ice_lance|frostbolt|frostfire_bolt|mirror_image: frostbolt|ice_nova|water_elemental: waterbolt|icicle_fb|icicle_ffb|frozen_orb_bolt|shattered_bleed|water_elemental: water_jet&
http://1.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Procrank+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:fjlosux02576753345421zzywwuttrqqpomligeecccbZYYWVVTSSSSTTTTUUTSSTTUVVVWWVVUUTTTSSSSSSSRQQQQRSSTTTTTTTTTTTTTTTTSRQQQRTUWWXXYZZabbcdeefffedcbbbbccccbbaaaaZZZZZZYYYWVUUTTTSSTUUUUVWWXXYZabcddefgfghiihgfffeeddccbbaZYWVUUUVWWVVVUUUTTTTTTSSSSSSSTTUVXYZZaabcddefffeeeddcbaaabbbbaaZZZZYYYYYXXWWWUTSSSSTTTSSSTTTTTTUUUUUUVUTTUUUVUUTTTSSSSSSSRRRRRRRQQRRSSTSSSSSSSSSSSSTTUUUUTSRQQPONML&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.448988,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=25311|max=56373&chxp=1,1,45,100 http://4.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Procrank+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,4,3,7,14,26,36,70,118,141,223,347,421,526,687,719,861,1032,1030,1165,1208,1258,1363,1302,1292,1353,1281,1301,1201,1037,979,881,704,602,479,346,294,208,152,108,74,54,37,20,11,13,7,2,0,1&chds=0,1363&chbh=5&chxt=x&chxl=0:|min=22102|avg=25311|max=28806&chxp=0,1,48,100& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Procrank+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:55.6,21.6,13.5,5.9,2.5,0.9&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,9900CC,0070DE,0070DE,69CCF0&chl=frostbolt 167.3s|ice_lance 65.0s|frostfire_bolt 40.5s|ice_nova 17.6s|frozen_orb 7.5s|mirror_image 2.8s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Procrank 25311
frostbolt 4423 (6211) 17.5% (24.6%) 99.6 2.99sec 18738 11152 Direct 99.3 9213 18561 10609 14.9% 84.4 2813 5693 15.5%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.58 99.34 0.00 0.00 1.6803 0.0000 1328937.25 1328937.25 0.00 11151.55 11151.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.04 15.45% 5693.14 5398 6543 5697.51 5398 6543 74253 74253 0.00
multistrike 71.35 84.55% 2813.42 2699 3271 2814.98 2735 2930 200745 200745 0.00
hit 84.50 85.06% 9212.56 8996 10904 9216.28 9045 9420 778421 778421 0.00
crit 14.84 14.94% 18560.92 17993 21809 18571.15 17993 20855 275518 275518 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:$?$w1=0[][Movement slowed by $w1%.]
  • description:Launches a bolt of frost at the enemy, causing {$s2=1256} Frost damage and slowing movement speed by {$s1=50}% for {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.191000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    icicle_fb 1788 7.1% 181.6 2.00sec 2956 0 Direct 180.5 2974 0 2974 0.0% 0.0 0 0 0.0%  

Stats details: icicle_fb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 181.64 180.55 0.00 0.00 0.0000 0.0000 536929.56 536929.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.55 100.00% 2973.93 1047 14162 2976.09 2329 3860 536930 536930 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:990.51
  • base_dd_max:990.51
 
frostfire_bolt 3613 (4944) 14.3% (19.5%) 30.9 9.46sec 47909 36534 Direct 30.9 15524 31366 27109 73.1% 29.4 4754 9643 73.9%  

Stats details: frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.92 30.86 0.00 0.00 1.3114 0.0000 1082580.69 1082580.69 0.00 36534.07 36534.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 21.73 73.86% 9643.32 9041 10959 9650.57 9041 10610 209529 209529 0.00
multistrike 7.69 26.14% 4753.97 4521 5480 4754.47 0 5480 36560 36560 0.00
hit 8.29 26.88% 15524.41 15069 18265 15531.92 0 18265 128743 128743 0.00
crit 22.56 73.12% 31366.47 30138 36530 31389.60 30138 33867 707748 707748 0.00
 
DPS Timeline Chart
 

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.brain_freeze.react
Spelldata
  • id:44614
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:Movement slowed by {$s1=40}%.
  • description:Launches a bolt of frostfire at the enemy, causing $?a57761[${$m2*1.25} to ${$M2*1.25}][{$s2=1672}] Frostfire damage and slowing the target's movement by {$s1=40}% for {$d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.586000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    icicle_ffb 1331 5.3% 59.6 5.16sec 6686 0 Direct 59.3 6719 0 6719 0.0% 0.0 0 0 0.0%  

Stats details: icicle_ffb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.64 59.35 0.00 0.00 0.0000 0.0000 398766.20 398766.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.35 100.00% 6719.31 1047 14162 6729.75 4892 8705 398766 398766 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:990.51
  • base_dd_max:990.51
 
frozen_orb 0 (863) 0.0% (3.4%) 5.4 61.00sec 47530 34431

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.44 5.44 53.27 53.27 1.3805 1.0000 0.00 0.00 0.00 4251.67 34431.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.44 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.7 82.09% 0.00 0 0 0.00 0 0 0 0 0.00
crit 9.5 17.91% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16000.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=405} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    frozen_orb_bolt 863 3.4% 0.0 0.00sec 0 0 Direct 53.3 3127 6244 3687 17.9% 53.9 976 1950 17.8%  

Stats details: frozen_orb_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 53.27 0.00 0.00 0.0000 0.0000 258373.85 258373.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.58 17.76% 1949.84 1738 2106 1951.65 0 2106 18680 18680 0.00
multistrike 44.37 82.24% 976.42 869 1053 977.62 930 1036 43321 43321 0.00
hit 43.71 82.06% 3127.30 2896 3510 3131.21 3007 3305 136691 136691 0.00
crit 9.56 17.94% 6244.42 5792 7020 6251.97 5792 7020 59682 59682 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=30}%.
  • description:{$@spelldesc84714=Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=405} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.383250
  • base_dd_min:1.00
  • base_dd_max:1.00
 
ice_lance 4598 18.2% 48.9 6.13sec 28242 21240 Direct 48.7 12602 25361 22044 74.0% 44.7 3897 7860 74.5%  

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.87 48.71 0.00 0.00 1.3296 0.0000 1380120.03 1380120.03 0.00 21240.46 21240.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 33.33 74.53% 7859.68 7250 8788 7867.00 7375 8504 262000 262000 0.00
multistrike 11.39 25.47% 3896.81 3625 4394 3900.49 0 4394 44402 44402 0.00
hit 12.66 26.00% 12602.21 12084 14647 12611.76 12084 14281 159576 159576 0.00
crit 36.04 74.00% 25361.21 24168 29295 25381.85 24329 27159 914143 914143 0.00
 
DPS Timeline Chart
 

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Deals $?a44544[${$m1*$<fingersMult>} to ${$M1*$<fingersMult>}][{$s1=422}] Frost damage to an enemy target{$?s56377=true}&!a44544[, and ${$m1*$56377m2/100} to ${$M1*$56377m2/100} Frost damage to a second nearby target][]{$?s56377=true}&a44544[, and ${$m1*$<fingersMult>*$56377m2/100} to ${$M1*$<fingersMult>*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is doubled against frozen targets. Replaces Fire Blast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
ice_nova 2184 8.6% 13.4 23.09sec 48696 37187 Direct 13.4 32103 64423 37116 15.5% 13.5 9952 19998 15.7%  

Stats details: ice_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.44 13.44 0.00 0.00 1.3095 0.0000 654610.36 654610.36 0.00 37187.43 37187.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.12 15.70% 19998.35 18128 21973 17801.01 0 21973 42389 42389 0.00
multistrike 11.38 84.30% 9951.69 9064 10986 9970.56 9064 10986 113275 113275 0.00
hit 11.36 84.49% 32102.63 30213 36621 32129.13 30213 34485 364610 364610 0.00
crit 2.09 15.51% 64423.41 60426 73242 57662.78 0 73242 134336 134336 0.00
 
DPS Timeline Chart
 

Action details: ice_nova

Static Values
  • id:157997
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2
Spelldata
  • id:157997
  • name:Ice Nova
  • school:frost
  • tooltip:Frozen.
  • description:Causes a whirl of icy wind around the target enemy or ally, dealing {$s2=2109} Frost damage to all enemies within $A2 yards, and freezing for {$d=2 seconds}. A primary enemy target will take {$s1=100}% increased damage. Max 2 charges. Replaces Frost Nova.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
mirror_image 0 (3529) 0.0% (13.9%) 3.0 120.63sec 350519 380257

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.9221 0.0000 0.00 0.00 0.00 380257.27 380257.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.56 84.91% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.45 15.09% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3200.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:
  • description:Creates {$s2=3} copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts {$55342d=40 seconds}.
 
    frostbolt (mirror_image) 9472 13.9% 196.9 4.16sec 5361 3229 Direct 195.9 3455 7001 4133 19.1% 192.7 1061 2160 19.6%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.91 195.95 0.00 0.00 1.6600 0.0000 1055594.17 1055594.17 0.00 3229.44 3229.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 37.68 19.55% 2159.61 1994 2417 2161.01 1994 2338 81365 81365 0.00
multistrike 155.02 80.45% 1060.54 997 1208 1061.16 1035 1100 164403 164403 0.00
hit 158.47 80.87% 3454.72 3323 4028 3456.69 3403 3552 547476 547476 0.00
crit 37.48 19.13% 7000.66 6646 8056 7006.13 6646 7586 262350 262350 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
shattered_bleed 444 1.8% 16.7 18.34sec 7974 0 Direct 16.7 1584 3169 1826 15.2% 14.6 475 951 15.5%  
Periodic 94.9 783 0 783 0.0% 86.4 238 0 0.0% 31.5%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.73 16.73 94.89 94.89 0.0000 1.0000 133429.95 133429.95 0.00 1406.11 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.26 15.54% 950.68 951 951 844.77 0 951 2151 2151 0.00
multistrike 12.30 84.46% 475.34 475 475 475.34 475 475 5845 5845 0.00
hit 14.18 84.75% 1584.46 1584 1584 1584.46 1584 1584 22471 22471 0.00
crit 2.55 15.25% 3168.92 3169 3169 2931.51 0 3169 8085 8085 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 86.4 100.00% 237.67 238 238 237.67 238 238 20532 20532 0.00
hit 94.9 100.00% 783.47 1 792 783.76 756 792 74346 74346 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - water_elemental 2539 / 2539
water_jet 443 1.8% 10.0 30.33sec 13323 3055 Periodic 39.7 2274 4588 2645 16.1% 34.1 705 1427 16.7% 11.6%

Stats details: water_jet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.00 10.00 39.69 39.69 4.3616 0.8776 133166.51 133166.51 0.00 3054.56 3054.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.7 16.70% 1427.25 1310 1588 1425.48 0 1588 8130 8130 0.00
multistrike 28.4 83.30% 704.81 655 794 705.84 667 766 20033 20033 0.00
hit 33.3 83.94% 2273.63 2184 2647 2275.27 2204 2352 75760 75760 0.00
crit 6.4 16.06% 4588.13 4367 5294 4586.28 0 5294 29243 29243 0.00
 
DPS Timeline Chart
 

Action details: water_jet

Static Values
  • id:135029
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking {$s1=0} damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.282000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
waterbolt 2095 8.3% 111.3 2.69sec 5653 2554 Direct 110.4 3870 7795 4466 15.2% 99.0 1187 2399 15.6%  

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.29 110.40 0.00 0.00 2.2133 0.0000 629157.51 629157.51 0.00 2554.11 2554.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 15.42 15.58% 2399.01 2253 2731 2400.83 2253 2731 36998 36998 0.00
multistrike 83.54 84.42% 1187.08 1127 1366 1187.85 1153 1242 99171 99171 0.00
hit 93.64 84.82% 3869.69 3756 4552 3871.55 3808 3946 362344 362344 0.00
crit 16.76 15.18% 7795.20 7511 9104 7799.74 7511 8706 130645 130645 0.00
 
DPS Timeline Chart
 

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals {$s1=511} Frost damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.485000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - mirror_image 9472 / 3529
frostbolt 9472 13.9% 196.9 4.16sec 5361 3229 Direct 195.9 3455 7001 4133 19.1% 192.7 1061 2160 19.6%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.91 195.95 0.00 0.00 1.6600 0.0000 1055594.17 1055594.17 0.00 3229.44 3229.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 37.68 19.55% 2159.61 1994 2417 2161.01 1994 2338 81365 81365 0.00
multistrike 155.02 80.45% 1060.54 997 1208 1061.16 1035 1100 164403 164403 0.00
hit 158.47 80.87% 3454.72 3323 4028 3456.69 3403 3552 547476 547476 0.00
crit 37.48 19.13% 7000.66 6646 8056 7006.13 6646 7586 262350 262350 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Procrank
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
icy_veins 2.1 181.57sec

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.05 2.05 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.77 86.02% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.29 13.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
 
water_elemental 1.0 0.00sec

Stats details: water_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.87 86.93% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.13 13.07% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: water_elemental

Static Values
  • id:31687
  • school:frost
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:4800.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:31687
  • name:Summon Water Elemental
  • school:frost
  • tooltip:
  • description:Summons a Water Elemental to fight for the caster.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
brain_freeze 25.0 6.1 11.9sec 9.5sec 20.87% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_brain_freeze
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • brain_freeze_1:20.15%
  • brain_freeze_2:0.71%

Trigger Attempt Success

  • trigger_pct:31.47%

Spelldata details

  • id:57761
  • name:Brain Freeze
  • tooltip:Your next Frostfire Bolt costs no mana, is instant cast, acts as if your target were frozen, and deals {$44549s3=85}% additional damage.
  • description:{$@spelldesc44549=Your Frostbolts have a $m1% chance to cause the Brain Freeze effect. Each multistrike increases that cast's chance by an additional $m2%. The Brain Freeze effect causes your next Frostfire Bolt to cost no mana, be instant cast, deal {$s3=85}% additional damage, and act as if your target were frozen.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
draenic_intellect_potion 2.0 0.0 180.9sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
enhanced_frostbolt 17.5 0.0 17.7sec 18.5sec 7.25% 17.51% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_enhanced_frostbolt
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enhanced_frostbolt_1:7.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157646
  • name:Enhanced Frostbolt
  • tooltip:
  • description:Frostbolt's cast time is reduced by 0.5 sec. This effect is disabled for {$157648d=15 seconds} after you benefit from it.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
fingers_of_frost 34.8 16.3 8.7sec 5.9sec 30.85% 100.00% 1.8(1.8)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • fingers_of_frost_1:26.35%
  • fingers_of_frost_2:4.50%

Trigger Attempt Success

  • trigger_pct:24.78%

Spelldata details

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance or Deep Freeze act as if your target were frozen and Ice Lance deals $w2% more damage.
  • description:{$@spelldesc112965=Your successful Frostbolts, Frostfire Bolts and Frozen Orb hits have a {$s1=15}% chance, and your Blizzard ticks have a {$s2=5}% chance to grant you the Fingers of Frost effect. The Fingers of Frost effect causes your next Ice Lance or Deep Freeze to act as if your target were frozen, and increases Ice Lance damage by {$44544s2=100}%. Limit {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
icy_veins 2.1 0.0 180.9sec 181.5sec 22.51% 24.54% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • icy_veins_1:22.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
nightmare_fire 2.9 0.0 121.7sec 121.6sec 18.94% 18.96% 0.0(0.0)

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_nightmare_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • nightmare_fire_1:18.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162919
  • name:Nightmare Fire
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
frost_armor

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • frost_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Multistrike increased by $7302w1%. Attackers are slowed.
  • description:Increases multistrike chance by {$s1=8}% and causes enemies who strike the caster to be slowed by {$7321s2=30}% for {$7321d=5 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Procrank
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Procrank
frostbolt Mana 99.6 637287.1 6400.0 6400.0 2.9
frozen_orb Mana 5.4 86974.2 16000.0 15999.8 3.0
ice_lance Mana 48.9 78189.5 1600.0 1600.0 17.7
mirror_image Mana 3.0 6436.9 2137.4 2137.4 164.0
Resource Gains Type Count Total Average Overflow
external_healing Health 8.05 0.00 (0.00%) 0.00 75246.89 100.00%
mp5_regen Mana 198.80 805326.80 (100.00%) 4050.95 174761.98 17.83%
Resource RPS-Gain RPS-Loss
Mana 2676.41 2688.24
Combat End Resource Mean Min Max
Mana 156475.66 138800.39 160000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
water_elemental 100.0%
water_elemental-water_elemental 100.0%
prismatic_crystal-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
Uptimes %
Mana Cap 22.2%
water_elemental-Mana Cap 22.2%
prismatic_crystal-Mana Cap 22.2%
mirror_image-Mana Cap 22.2%
mirror_image-Mana Cap 22.2%
mirror_image-Mana Cap 22.2%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Procrank Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Procrank Damage Per Second
Count 25000
Mean 25311.01
Minimum 22101.93
Maximum 28806.33
Spread ( max - min ) 6704.40
Range [ ( max - min ) / 2 * 100% ] 13.24%
Standard Deviation 926.7621
5th Percentile 23795.08
95th Percentile 26820.11
( 95th Percentile - 5th Percentile ) 3025.03
Mean Distribution
Standard Deviation 5.8614
95.00% Confidence Intervall ( 25299.53 - 25322.50 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5150
0.1 Scale Factor Error with Delta=300 7331
0.05 Scale Factor Error with Delta=300 29327
0.01 Scale Factor Error with Delta=300 733196
Distribution Chart
DPS(e)
Sample Data Procrank Damage Per Second (Effective)
Count 25000
Mean 25311.01
Minimum 22101.93
Maximum 28806.33
Spread ( max - min ) 6704.40
Range [ ( max - min ) / 2 * 100% ] 13.24%
Damage
Sample Data Procrank Damage
Count 25000
Mean 5773747.89
Minimum 4254180.01
Maximum 7567005.18
Spread ( max - min ) 3312825.17
Range [ ( max - min ) / 2 * 100% ] 28.69%
DTPS
Sample Data Procrank Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Procrank Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Procrank Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Procrank Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Procrank Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Procrank Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ProcrankTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Procrank Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=calamari_crepes
2 0.00 arcane_brilliance
3 0.00 water_elemental
4 0.00 snapshot_stats
5 0.00 rune_of_power
6 0.00 mirror_image
7 0.00 potion,name=draenic_intellect
8 0.00 frostbolt
Default action list Executed every time the actor is available.
# count action,conditions
9 0.00 counterspell,if=target.debuff.casting.react
A 0.00 blink,if=movement.distance>10
B 0.00 blazing_speed,if=movement.remains>0
C 0.00 time_warp,if=target.health.pct<25|time>5
D 2.01 mirror_image
E 0.00 ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
F 0.00 rune_of_power,if=buff.rune_of_power.remains<cast_time
G 0.00 rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
H 0.00 call_action_list,name=cooldowns,if=time_to_die<24
I 0.00 call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
J 0.00 call_action_list,name=aoe,if=active_enemies>=4
K 0.00 call_action_list,name=single_target
actions.cooldowns
# count action,conditions
X 2.05 icy_veins
Consolidated damage cooldown abilities
Y 0.00 blood_fury
Z 0.00 berserking
a 0.00 arcane_torrent
b 1.00 potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up
actions.single_target
# count action,conditions
j 0.00 call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
Single target sequence
k 0.01 ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
Safeguards against losing FoF and BF to buff expiry
l 0.00 frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
m 0.00 frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
Frozen Orb usage without Prismatic Crystal
n 5.44 frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
o 0.00 frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
p 1.17 ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
q 21.98 ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
r 0.00 comet_storm
s 12.27 ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
t 30.92 frostfire_bolt,if=buff.brain_freeze.react
u 0.00 ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
v 0.00 ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
w 0.00 frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
Camp procs and spam Frostbolt while 4T17 buff is up
x 26.88 ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
y 10.02 water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
z 99.12 frostbolt
{ 0.00 ice_lance,moving=1

Sample Sequence

013678XnpqqstqzztxyzzxxzzttxzztstzzttzzzyztxxzztqxzszztqnqqzzzqyzzxxszzztzzzzzzzyztxsxzzzztzzzzDnqqtszzyzxzxzzxzztxzszzzyzzxxzzztzzttzzXbsnqqtqqzzxtxyzzsqtqxzzttzzzzzzxsyzztqtxzzDtqnqqtqszzyzxxzzzzttzzttszztxyzzxx

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana
Pre food Fluffy_Pillow 160000.0/160000: 100% mana
Pre water_elemental Fluffy_Pillow 160000.0/160000: 100% mana
Pre mirror_image Fluffy_Pillow 160000.0/160000: 100% mana
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana draenic_intellect_potion
0:00.000 frostbolt Fluffy_Pillow 153600.0/160000: 96% mana brain_freeze, nightmare_fire, draenic_intellect_potion
0:00.000 icy_veins Fluffy_Pillow 153600.0/160000: 96% mana brain_freeze, nightmare_fire, draenic_intellect_potion
0:00.000 frozen_orb Fluffy_Pillow 153600.0/160000: 96% mana brain_freeze, icy_veins, nightmare_fire, draenic_intellect_potion
0:01.380 ice_nova Fluffy_Pillow 143232.3/160000: 90% mana bloodlust, brain_freeze, fingers_of_frost(2), icy_veins, nightmare_fire, draenic_intellect_potion
0:02.444 ice_lance Fluffy_Pillow 147574.9/160000: 92% mana bloodlust, brain_freeze, fingers_of_frost(2), icy_veins, nightmare_fire, draenic_intellect_potion
0:03.508 ice_lance Fluffy_Pillow 150317.5/160000: 94% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:04.569 ice_nova Fluffy_Pillow 153047.8/160000: 96% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, draenic_intellect_potion
0:05.631 frostfire_bolt Fluffy_Pillow 157382.2/160000: 98% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, draenic_intellect_potion
0:06.694 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:07.756 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, enhanced_frostbolt, nightmare_fire, draenic_intellect_potion
0:08.819 frostbolt Fluffy_Pillow 157938.5/160000: 99% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, draenic_intellect_potion
0:10.234 frostfire_bolt Fluffy_Pillow 157313.6/160000: 98% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:11.297 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:12.358 water_jet Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:12.358 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:13.773 frostbolt Fluffy_Pillow 159375.1/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:15.188 ice_lance Fluffy_Pillow 158750.3/160000: 99% mana bloodlust, fingers_of_frost(2), icy_veins, nightmare_fire, draenic_intellect_potion
0:16.252 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:17.314 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:18.730 frostbolt Fluffy_Pillow 159379.2/160000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:20.145 frostfire_bolt Fluffy_Pillow 158754.4/160000: 99% mana bloodlust, brain_freeze(2), fingers_of_frost, icy_veins
0:21.207 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins
0:22.270 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost, icy_veins
0:23.333 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins
0:24.748 frostbolt Fluffy_Pillow 159375.1/160000: 100% mana bloodlust, brain_freeze, icy_veins, enhanced_frostbolt
0:25.810 frostfire_bolt Fluffy_Pillow 157309.6/160000: 98% mana bloodlust, brain_freeze(2), icy_veins
0:26.872 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, brain_freeze, icy_veins
0:27.933 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, brain_freeze, icy_veins
0:28.996 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins
0:30.412 frostbolt Fluffy_Pillow 159379.2/160000: 100% mana bloodlust, brain_freeze, icy_veins
0:31.827 frostfire_bolt Fluffy_Pillow 158754.4/160000: 99% mana bloodlust, brain_freeze(2), icy_veins
0:32.888 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, brain_freeze, icy_veins
0:33.951 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, icy_veins
0:35.366 frostbolt Fluffy_Pillow 159375.1/160000: 100% mana bloodlust
0:36.783 frostbolt Fluffy_Pillow 158758.4/160000: 99% mana bloodlust
0:38.198 water_jet Fluffy_Pillow 158133.6/160000: 99% mana bloodlust, brain_freeze
0:38.198 frostbolt Fluffy_Pillow 158133.6/160000: 99% mana bloodlust, brain_freeze
0:39.613 frostfire_bolt Fluffy_Pillow 157508.7/160000: 98% mana bloodlust, brain_freeze, fingers_of_frost
0:40.674 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, fingers_of_frost(2)
0:41.740 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
0:43.120 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
0:44.500 frostbolt Fluffy_Pillow 157932.5/160000: 99% mana brain_freeze, fingers_of_frost
0:46.337 frostfire_bolt Fluffy_Pillow 157299.8/160000: 98% mana brain_freeze, fingers_of_frost(2)
0:47.721 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost(2)
0:49.100 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
0:50.482 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
0:52.320 ice_nova Fluffy_Pillow 159370.4/160000: 100% mana
0:53.699 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
0:55.537 frostbolt Fluffy_Pillow 159370.4/160000: 100% mana brain_freeze, fingers_of_frost
0:57.376 frostfire_bolt Fluffy_Pillow 158744.0/160000: 99% mana brain_freeze, fingers_of_frost(2)
0:58.757 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost(2)
1:00.139 frozen_orb Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
1:01.518 ice_lance Fluffy_Pillow 148329.4/160000: 93% mana fingers_of_frost(2)
1:02.897 ice_lance Fluffy_Pillow 151058.8/160000: 94% mana fingers_of_frost
1:04.277 frostbolt Fluffy_Pillow 153791.3/160000: 96% mana enhanced_frostbolt
1:05.657 frostbolt Fluffy_Pillow 151723.9/160000: 95% mana
1:07.496 frostbolt Fluffy_Pillow 151097.4/160000: 94% mana fingers_of_frost
1:09.334 ice_lance Fluffy_Pillow 150467.9/160000: 94% mana fingers_of_frost
1:10.715 water_jet Fluffy_Pillow 153203.5/160000: 96% mana
1:10.715 frostbolt Fluffy_Pillow 153203.5/160000: 96% mana
1:12.554 frostbolt Fluffy_Pillow 152577.1/160000: 95% mana
1:14.391 ice_lance Fluffy_Pillow 151944.4/160000: 95% mana fingers_of_frost
1:15.772 ice_lance Fluffy_Pillow 154680.1/160000: 97% mana fingers_of_frost
1:17.153 ice_nova Fluffy_Pillow 157415.7/160000: 98% mana
1:18.532 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
1:20.371 frostbolt Fluffy_Pillow 159373.6/160000: 100% mana
1:22.208 frostbolt Fluffy_Pillow 158740.9/160000: 99% mana brain_freeze, enhanced_frostbolt
1:23.589 frostfire_bolt Fluffy_Pillow 156676.5/160000: 98% mana brain_freeze
1:24.970 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
1:26.811 frostbolt Fluffy_Pillow 159379.9/160000: 100% mana
1:28.648 frostbolt Fluffy_Pillow 158747.1/160000: 99% mana
1:30.486 frostbolt Fluffy_Pillow 158117.6/160000: 99% mana
1:32.324 frostbolt Fluffy_Pillow 157488.0/160000: 98% mana
1:34.162 frostbolt Fluffy_Pillow 156858.4/160000: 98% mana
1:36.002 frostbolt Fluffy_Pillow 156235.1/160000: 98% mana
1:37.841 water_jet Fluffy_Pillow 155608.7/160000: 97% mana brain_freeze
1:37.841 frostbolt Fluffy_Pillow 155608.7/160000: 97% mana brain_freeze
1:39.678 frostfire_bolt Fluffy_Pillow 154976.0/160000: 97% mana brain_freeze, fingers_of_frost
1:41.059 ice_lance Fluffy_Pillow 159311.7/160000: 100% mana fingers_of_frost(2)
1:42.440 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
1:43.821 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
1:45.203 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
1:46.584 frostbolt Fluffy_Pillow 157935.7/160000: 99% mana
1:48.425 frostbolt Fluffy_Pillow 157315.5/160000: 98% mana
1:50.262 frostbolt Fluffy_Pillow 156682.8/160000: 98% mana brain_freeze
1:52.100 frostfire_bolt Fluffy_Pillow 156053.2/160000: 98% mana brain_freeze
1:53.481 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
1:55.319 frostbolt Fluffy_Pillow 159370.4/160000: 100% mana
1:57.158 frostbolt Fluffy_Pillow 158744.0/160000: 99% mana
1:58.995 frostbolt Fluffy_Pillow 158111.3/160000: 99% mana
2:00.834 mirror_image Fluffy_Pillow 157484.9/160000: 98% mana brain_freeze, fingers_of_frost, nightmare_fire
2:02.214 frozen_orb Fluffy_Pillow 158617.4/160000: 99% mana brain_freeze, fingers_of_frost, nightmare_fire
2:03.595 ice_lance Fluffy_Pillow 146953.1/160000: 92% mana brain_freeze, fingers_of_frost(2), nightmare_fire
2:04.976 ice_lance Fluffy_Pillow 149688.7/160000: 94% mana brain_freeze, fingers_of_frost, nightmare_fire
2:06.355 frostfire_bolt Fluffy_Pillow 152418.1/160000: 95% mana brain_freeze, nightmare_fire
2:07.736 ice_nova Fluffy_Pillow 156753.8/160000: 98% mana nightmare_fire
2:09.117 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt, nightmare_fire
2:10.497 frostbolt Fluffy_Pillow 157932.5/160000: 99% mana nightmare_fire
2:12.335 water_jet Fluffy_Pillow 157303.0/160000: 98% mana fingers_of_frost, nightmare_fire
2:12.335 frostbolt Fluffy_Pillow 157303.0/160000: 98% mana fingers_of_frost, nightmare_fire
2:14.170 ice_lance Fluffy_Pillow 156664.0/160000: 98% mana fingers_of_frost, nightmare_fire
2:15.548 frostbolt Fluffy_Pillow 159390.2/160000: 100% mana fingers_of_frost, nightmare_fire
2:17.386 ice_lance Fluffy_Pillow 158760.7/160000: 99% mana fingers_of_frost, nightmare_fire
2:18.768 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
2:20.608 frostbolt Fluffy_Pillow 159376.7/160000: 100% mana fingers_of_frost, nightmare_fire
2:22.446 ice_lance Fluffy_Pillow 158747.1/160000: 99% mana fingers_of_frost
2:23.828 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
2:25.666 frostbolt Fluffy_Pillow 159370.4/160000: 100% mana brain_freeze, fingers_of_frost, enhanced_frostbolt
2:27.047 frostfire_bolt Fluffy_Pillow 157306.1/160000: 98% mana brain_freeze, fingers_of_frost
2:28.427 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
2:29.807 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
2:31.644 ice_nova Fluffy_Pillow 159367.3/160000: 100% mana
2:33.025 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
2:34.863 frostbolt Fluffy_Pillow 159370.4/160000: 100% mana
2:36.703 frostbolt Fluffy_Pillow 158747.1/160000: 99% mana
2:38.541 water_jet Fluffy_Pillow 158117.6/160000: 99% mana
2:38.541 frostbolt Fluffy_Pillow 158117.6/160000: 99% mana
2:40.380 frostbolt Fluffy_Pillow 157491.1/160000: 98% mana
2:42.218 ice_lance Fluffy_Pillow 156861.6/160000: 98% mana fingers_of_frost
2:43.599 ice_lance Fluffy_Pillow 159597.3/160000: 100% mana fingers_of_frost
2:44.978 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
2:46.360 frostbolt Fluffy_Pillow 157938.8/160000: 99% mana
2:48.198 frostbolt Fluffy_Pillow 157309.2/160000: 98% mana brain_freeze
2:50.037 frostfire_bolt Fluffy_Pillow 156682.8/160000: 98% mana brain_freeze
2:51.418 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
2:53.255 frostbolt Fluffy_Pillow 159367.3/160000: 100% mana brain_freeze
2:55.093 frostfire_bolt Fluffy_Pillow 158737.7/160000: 99% mana brain_freeze(2)
2:56.474 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze
2:57.856 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
2:59.695 frostbolt Fluffy_Pillow 159373.6/160000: 100% mana fingers_of_frost
3:01.534 icy_veins Fluffy_Pillow 158747.1/160000: 99% mana brain_freeze, fingers_of_frost
3:01.534 potion Fluffy_Pillow 158747.1/160000: 99% mana brain_freeze, fingers_of_frost, icy_veins
3:01.534 ice_nova Fluffy_Pillow 158747.1/160000: 99% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:02.914 frozen_orb Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:04.294 ice_lance Fluffy_Pillow 148332.5/160000: 93% mana brain_freeze, fingers_of_frost(2), icy_veins, draenic_intellect_potion
3:05.673 ice_lance Fluffy_Pillow 151061.9/160000: 94% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:07.054 frostfire_bolt Fluffy_Pillow 153797.6/160000: 96% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:08.436 ice_lance Fluffy_Pillow 158136.4/160000: 99% mana fingers_of_frost(2), icy_veins, draenic_intellect_potion
3:09.815 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:11.195 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana icy_veins, enhanced_frostbolt, draenic_intellect_potion
3:12.576 frostbolt Fluffy_Pillow 157935.7/160000: 99% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:14.416 ice_lance Fluffy_Pillow 157312.4/160000: 98% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:15.797 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, icy_veins, draenic_intellect_potion
3:17.177 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:18.559 water_jet Fluffy_Pillow 160000.0/160000: 100% mana icy_veins, draenic_intellect_potion
3:18.559 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana icy_veins, draenic_intellect_potion
3:20.398 frostbolt Fluffy_Pillow 159373.6/160000: 100% mana brain_freeze, icy_veins, draenic_intellect_potion
3:22.237 ice_nova Fluffy_Pillow 158747.1/160000: 99% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:23.617 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost(2), icy_veins, draenic_intellect_potion
3:24.999 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:26.379 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost(2), icy_veins, draenic_intellect_potion
3:27.760 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost, icy_veins
3:29.140 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana icy_veins, enhanced_frostbolt
3:30.520 frostbolt Fluffy_Pillow 157932.5/160000: 99% mana brain_freeze, icy_veins
3:32.358 frostfire_bolt Fluffy_Pillow 157303.0/160000: 98% mana brain_freeze(2), icy_veins
3:33.737 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, icy_veins
3:35.118 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana icy_veins
3:36.958 frostbolt Fluffy_Pillow 159376.7/160000: 100% mana icy_veins
3:38.798 frostbolt Fluffy_Pillow 158753.4/160000: 99% mana icy_veins
3:40.636 frostbolt Fluffy_Pillow 158123.9/160000: 99% mana
3:42.474 frostbolt Fluffy_Pillow 157494.3/160000: 98% mana
3:44.314 frostbolt Fluffy_Pillow 156871.0/160000: 98% mana fingers_of_frost
3:46.154 ice_lance Fluffy_Pillow 156247.7/160000: 98% mana fingers_of_frost
3:47.535 ice_nova Fluffy_Pillow 158983.4/160000: 99% mana
3:48.915 water_jet Fluffy_Pillow 160000.0/160000: 100% mana
3:48.915 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
3:50.296 frostbolt Fluffy_Pillow 157935.7/160000: 99% mana brain_freeze
3:52.134 frostfire_bolt Fluffy_Pillow 157306.1/160000: 98% mana brain_freeze(2), fingers_of_frost
3:53.513 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost(2)
3:54.894 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost
3:56.274 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
3:57.654 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
3:59.491 frostbolt Fluffy_Pillow 159367.3/160000: 100% mana brain_freeze
4:01.330 mirror_image Fluffy_Pillow 158740.9/160000: 99% mana brain_freeze(2), fingers_of_frost, nightmare_fire
4:02.711 frostfire_bolt Fluffy_Pillow 159876.5/160000: 100% mana brain_freeze(2), fingers_of_frost, nightmare_fire
4:04.090 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost(2), nightmare_fire
4:05.471 frozen_orb Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze, fingers_of_frost, nightmare_fire
4:06.851 ice_lance Fluffy_Pillow 148332.5/160000: 93% mana brain_freeze, fingers_of_frost(2), nightmare_fire
4:08.231 ice_lance Fluffy_Pillow 151065.1/160000: 94% mana brain_freeze, fingers_of_frost, nightmare_fire
4:09.612 frostfire_bolt Fluffy_Pillow 153800.7/160000: 96% mana brain_freeze, fingers_of_frost, nightmare_fire
4:10.991 ice_lance Fluffy_Pillow 158130.1/160000: 99% mana fingers_of_frost, nightmare_fire
4:12.371 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana nightmare_fire
4:13.751 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt, nightmare_fire
4:15.133 frostbolt Fluffy_Pillow 157938.8/160000: 99% mana nightmare_fire
4:16.971 water_jet Fluffy_Pillow 157309.2/160000: 98% mana fingers_of_frost, nightmare_fire
4:16.971 frostbolt Fluffy_Pillow 157309.2/160000: 98% mana fingers_of_frost, nightmare_fire
4:18.809 ice_lance Fluffy_Pillow 156679.7/160000: 98% mana fingers_of_frost, nightmare_fire
4:20.189 ice_lance Fluffy_Pillow 159412.2/160000: 100% mana fingers_of_frost, nightmare_fire
4:21.569 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
4:23.407 frostbolt Fluffy_Pillow 159370.4/160000: 100% mana
4:25.245 frostbolt Fluffy_Pillow 158740.9/160000: 99% mana
4:27.084 frostbolt Fluffy_Pillow 158114.4/160000: 99% mana brain_freeze
4:28.920 frostfire_bolt Fluffy_Pillow 157478.6/160000: 98% mana brain_freeze(2)
4:30.301 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze
4:31.680 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana enhanced_frostbolt
4:33.061 frostbolt Fluffy_Pillow 157935.7/160000: 99% mana brain_freeze
4:34.900 frostfire_bolt Fluffy_Pillow 157309.2/160000: 98% mana brain_freeze(2)
4:36.280 frostfire_bolt Fluffy_Pillow 160000.0/160000: 100% mana brain_freeze
4:37.662 ice_nova Fluffy_Pillow 160000.0/160000: 100% mana
4:39.044 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
4:40.882 frostbolt Fluffy_Pillow 159370.4/160000: 100% mana brain_freeze
4:42.719 frostfire_bolt Fluffy_Pillow 158737.7/160000: 99% mana brain_freeze, fingers_of_frost
4:44.098 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost
4:45.479 water_jet Fluffy_Pillow 160000.0/160000: 100% mana
4:45.479 frostbolt Fluffy_Pillow 160000.0/160000: 100% mana
4:47.316 frostbolt Fluffy_Pillow 159367.3/160000: 100% mana
4:49.155 ice_lance Fluffy_Pillow 158740.9/160000: 99% mana fingers_of_frost
4:50.537 ice_lance Fluffy_Pillow 160000.0/160000: 100% mana fingers_of_frost

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 748 713 713
Agility 998 951 951
Stamina 4354 3959 3959
Intellect 4146 3687 3567 (2405)
Spirit 1157 1157 1157
Health 261240 237540 0
Mana 160000 160000 0
Spell Power 5720 4741 1054
Crit 15.85% 10.85% 644
Haste 9.01% 3.82% 382
Multistrike 33.70% 19.11% 1261
Damage / Heal Versatility 5.63% 2.63% 342
ManaReg per Second 3140 2990 0
Mastery 36.70% 26.70% 588
Armor 637 637 637
Run Speed 0 0 68

Talents

Level
15 Evanesce Blazing Speed Ice Floes
30 Alter Time Flameglow Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Frost Bomb (Frost Mage) Unstable Magic Ice Nova (Frost Mage)
90 Mirror Image Rune of Power Incanter's Flow
100 Thermal Void (Frost Mage) Prismatic Crystal Comet Storm (Frost Mage)

Profile

mage="Procrank"
origin="http://eu.battle.net/wow/en/character/forscherliga/Procrank/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/182/59746230-avatar.jpg"
level=100
race=draenei
role=spell
position=back
professions=tailoring=643/inscription=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#eb!2201200
glyphs=icy_veins/water_elemental/splitting_ice/unbound_elemental/illusion/rapid_teleportation
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/arcane_brilliance
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/rune_of_power
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/frostbolt

# Executed every time the actor is available.

actions=counterspell,if=target.debuff.casting.react
actions+=/blink,if=movement.distance>10
actions+=/blazing_speed,if=movement.remains>0
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/mirror_image
actions+=/ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
actions+=/rune_of_power,if=buff.rune_of_power.remains<cast_time
actions+=/rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
actions+=/call_action_list,name=cooldowns,if=time_to_die<24
actions+=/call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
actions+=/call_action_list,name=aoe,if=active_enemies>=4
actions+=/call_action_list,name=single_target

# Actions while Prismatic Crystal is active
actions.crystal_sequence=frost_bomb,if=active_enemies=1&current_target!=prismatic_crystal&remains<10
actions.crystal_sequence+=/frozen_orb
actions.crystal_sequence+=/call_action_list,name=cooldowns
actions.crystal_sequence+=/prismatic_crystal
actions.crystal_sequence+=/frost_bomb,if=talent.prismatic_crystal.enabled&current_target=prismatic_crystal&active_enemies>1&!ticking
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
actions.crystal_sequence+=/ice_nova,if=charges=2
actions.crystal_sequence+=/frostfire_bolt,if=buff.brain_freeze.react
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react
actions.crystal_sequence+=/ice_nova
actions.crystal_sequence+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2),if=active_enemies>=5
actions.crystal_sequence+=/frostbolt

# Consolidated damage cooldown abilities
actions.cooldowns=icy_veins
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up

# AoE sequence
actions.aoe=call_action_list,name=cooldowns
actions.aoe+=/frost_bomb,if=remains<action.ice_lance.travel_time&(cooldown.frozen_orb.remains<gcd.max|buff.fingers_of_frost.react=2)
actions.aoe+=/frozen_orb
actions.aoe+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.up
actions.aoe+=/comet_storm
actions.aoe+=/ice_nova
actions.aoe+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2)

# Single target sequence
actions.single_target=call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
# Safeguards against losing FoF and BF to buff expiry
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
# Frozen Orb usage without Prismatic Crystal
actions.single_target+=/frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
actions.single_target+=/frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
# Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
actions.single_target+=/frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
actions.single_target+=/ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
actions.single_target+=/comet_storm
actions.single_target+=/ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react
actions.single_target+=/ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
actions.single_target+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
# Camp procs and spam Frostbolt while 4T17 buff is up
actions.single_target+=/frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
actions.single_target+=/ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
actions.single_target+=/water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
actions.single_target+=/frostbolt
actions.single_target+=/ice_lance,moving=1

head=ironburner_cowl,id=118964,bonus_id=233
neck=odyssian_choker,id=113833,bonus_id=566,enchant=75mult
shoulders=mantle_of_volatile_ice,id=114517,bonus_id=202/563,gems=35mult
back=kyusys_tarflame_doomcloak,id=119346,bonus_id=42,enchant=gift_of_multistrike
chest=robes_of_the_arcane_ultimatum,id=113850,bonus_id=43
shirt=sightless_mantle,id=98093
tabard=stormwind_tabard,id=118365
wrists=bracers_of_arcane_mystery,id=109864,bonus_id=524
hands=hexweave_gloves,id=114812,bonus_id=189/525/538
waist=cord_of_winsome_sorrows,id=119336,bonus_id=566
legs=seacursed_leggings,id=113828,bonus_id=566
feet=ironburner_sandals,id=118968,bonus_id=181
finger1=diamondglow_circle,id=109763,bonus_id=523/524,gems=35mult,enchant=30mult
finger2=timeless_solium_band_of_the_archmage,id=118296,enchant=30mult
trinket1=sandmans_pouch,id=112320,bonus_id=525/529
trinket2=grandiose_power,id=114550
main_hand=blackfire_spellblade,id=118984,bonus_id=220,enchant=mark_of_the_shattered_hand
off_hand=bileslingers_censer,id=113592,bonus_id=566

# Gear Summary
# gear_stamina=3069
# gear_intellect=2405
# gear_spell_power=1054
# gear_crit_rating=644
# gear_haste_rating=382
# gear_mastery_rating=588
# gear_armor=637
# gear_multistrike_rating=1201
# gear_versatility_rating=342
# gear_speed_rating=68

Zentimeter

Zentimeter : 23993 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
23993.4 23993.4 11.2 / 0.047% 3453.4 / 14.4% 6.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
2771.0 2771.0 Mana 0.00% 43.2 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Zentimeter/advanced
Talents
  • 15: Ice Floes
  • 30: Ice Barrier
  • 45: Ring of Frost
  • 60: Cauterize
  • 75: Ice Nova (Frost Mage)
  • 90: Mirror Image
  • 100: Thermal Void (Frost Mage)
  • Talent Calculator
Glyphs
  • Glyph of Icy Veins
  • Glyph of Splitting Ice
  • Glyph of Water Elemental
  • Glyph of Conjure Familiar
  • Glyph of Evaporation
  • Glyph of Momentum
Professions
  • tailoring: 685
  • enchanting: 675

Charts

http://5.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Zentimeter+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:373092|36236|35617|32891|20236|10951&chds=0,746185&chco=69CCF0,9900CC,0070DE,0070DE,0070DE,0070DE&chm=t++373092++mirror_image,69CCF0,0,0,15|t++36236++frostfire_bolt,9900CC,1,0,15|t++35617++ice_nova,0070DE,2,0,15|t++32891++frozen_orb,0070DE,3,0,15|t++20236++ice_lance,0070DE,4,0,15|t++10951++frostbolt,0070DE,5,0,15& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zentimeter+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:24,24,19,18,12,11,11,8,4,2&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,0070DE,9900CC,0070DE,0070DE,0070DE,9900CC,0070DE,0070DE&chl=ice_lance|frostbolt|mirror_image: frostbolt|frostfire_bolt|water_elemental: waterbolt|ice_nova|icicle_fb|icicle_ffb|frozen_orb_bolt|water_elemental: water_jet&
http://8.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Zentimeter+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:ehknruwz2465842343220zzxvtttrrqpnnlkhfdccbbZZXWVUTSRRRSSSTTTTTSSSSUVVVVVUUTTTSSSRRRRRRQPPPPQRSSSSSSSSSSSSSSSSSSRPPQRSUVVWXXYYZaabcddeeedcbaaabbbbbaaZZZZZYYYYYYYXWVUUTTSSSTTTTTUVWWXXYZabcdeefefhhhgffeeeddcbbbaZZYWUUUTUVVVUUUTTTSSSSSSSRRSRRSSTUWXYYZZabccdeeeeddccbaZZZabaaZZZZYYYYYYXXXWWVUSSSRSTSSSSSSSSSSTTTTTUUUTTTTTUUUTTSSSRRRRRRRRQQQRQPQQRRSSSSSSSSSRRRRSSSTTTTSRQQPONMML&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.436392,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=23993|max=54981&chxp=1,1,44,100 http://1.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Zentimeter+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,1,4,12,20,39,72,103,170,246,319,453,522,680,813,877,1016,1145,1144,1228,1243,1321,1344,1275,1323,1276,1262,1121,1107,960,825,697,576,503,369,270,202,146,122,76,41,33,16,6,10,5,2,1,1,1&chds=0,1344&chbh=5&chxt=x&chxl=0:|min=21001|avg=23993|max=27557&chxp=0,1,46,100& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zentimeter+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:56.6,21.3,13.0,5.7,2.4,0.9&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,9900CC,0070DE,0070DE,69CCF0&chl=frostbolt 170.3s|ice_lance 64.1s|frostfire_bolt 39.0s|ice_nova 17.2s|frozen_orb 7.3s|mirror_image 2.7s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Zentimeter 23993
frostbolt 4258 (6208) 17.8% (25.9%) 103.4 2.88sec 18045 10951 Direct 103.1 8847 17842 9995 12.8% 80.8 2708 5493 13.3%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.36 103.11 0.00 0.00 1.6478 0.0000 1279407.13 1279407.13 0.00 10951.22 10951.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.75 13.30% 5492.64 5177 6321 5497.67 5177 6321 59038 59038 0.00
multistrike 70.05 86.70% 2708.28 2589 3161 2709.90 2621 2848 189703 189703 0.00
hit 89.95 87.23% 8846.61 8629 10535 8850.31 8706 9047 795727 795727 0.00
crit 13.17 12.77% 17842.06 17258 21071 17854.11 17258 21071 234939 234939 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:$?$w1=0[][Movement slowed by $w1%.]
  • description:Launches a bolt of frost at the enemy, causing {$s2=1310} Frost damage and slowing movement speed by {$s1=50}% for {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.191000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    icicle_fb 1950 8.1% 181.8 1.97sec 3221 0 Direct 180.7 3241 0 3241 0.0% 0.0 0 0 0.0%  

Stats details: icicle_fb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 181.84 180.74 0.00 0.00 0.0000 0.0000 585749.95 585749.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.74 100.00% 3240.90 1146 15627 3242.84 2571 4248 585750 585750 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1817.67
  • base_dd_max:1817.67
 
frostfire_bolt 3320 (4716) 13.8% (19.6%) 30.4 9.62sec 46448 36236 Direct 30.4 14935 30168 25567 69.8% 27.6 4584 9297 70.7%  

Stats details: frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.41 30.35 0.00 0.00 1.2819 0.0000 994381.46 994381.46 0.00 36235.51 36235.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 19.51 70.74% 9297.45 8672 10588 9304.59 8672 10349 181424 181424 0.00
multistrike 8.07 29.26% 4584.25 4336 5294 4585.94 0 5294 37006 37006 0.00
hit 9.17 30.21% 14935.11 14453 17647 14943.10 0 17647 136931 136931 0.00
crit 21.18 69.79% 30168.13 28907 35293 30192.22 28907 32739 639020 639020 0.00
 
DPS Timeline Chart
 

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:0.000
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.brain_freeze.react
Spelldata
  • id:44614
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:Movement slowed by {$s1=40}%.
  • description:Launches a bolt of frostfire at the enemy, causing $?a57761[${$m2*1.25} to ${$M2*1.25}][{$s2=1743}] Frostfire damage and slowing the target's movement by {$s1=40}% for {$d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.586000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    icicle_ffb 1396 5.8% 57.3 5.35sec 7295 0 Direct 57.1 7331 0 7331 0.0% 0.0 0 0 0.0%  

Stats details: icicle_ffb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.33 57.06 0.00 0.00 0.0000 0.0000 418259.92 418259.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.06 100.00% 7330.64 1146 15627 7343.60 5666 9681 418260 418260 0.00
 
DPS Timeline Chart
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt and Frostfire Bolt, and their multistrikes, {$s1=0}% of the damage done is stored as an Icicle with you, for {$148012d=30 seconds}. Also increases the damage of your Water Elemental's Waterbolt by {$s3=0}%. Up to {$s2=5} Icicles can be stored at once. Casting Ice Lance causes any Icicles to begin launching at the target.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1817.67
  • base_dd_max:1817.67
 
frozen_orb 0 (806) 0.0% (3.4%) 5.4 61.07sec 44417 32891

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.43 5.43 53.23 53.23 1.3505 1.0000 0.00 0.00 0.00 3983.78 32891.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.8 84.24% 0.00 0 0 0.00 0 0 0 0 0.00
crit 8.4 15.76% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16000.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=422} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    frozen_orb_bolt 806 3.4% 0.0 0.00sec 0 0 Direct 53.2 3009 6004 3480 15.7% 51.3 944 1886 15.6%  

Stats details: frozen_orb_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 53.23 0.00 0.00 0.0000 0.0000 241289.78 241289.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 8.03 15.64% 1885.60 1667 2035 1886.93 0 2035 15139 15139 0.00
multistrike 43.30 84.36% 944.38 833 1017 945.55 902 1004 40889 40889 0.00
hit 44.86 84.27% 3009.22 2778 3391 3013.13 2915 3164 134994 134994 0.00
crit 8.37 15.73% 6004.22 5555 6782 6010.34 0 6782 50268 50268 0.00
 
DPS Timeline Chart
 

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=30}%.
  • description:{$@spelldesc84714=Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal {$84721s2=422} Frost damage to all nearby enemy targets for {$d=10 seconds}. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by {$84721s1=30}% for {$84721d=2 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.383250
  • base_dd_min:1.00
  • base_dd_max:1.00
 
ice_lance 4325 18.0% 49.3 6.07sec 26305 20236 Direct 49.2 12114 24371 20770 70.6% 42.6 3759 7582 71.3%  

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.34 49.18 0.00 0.00 1.2999 0.0000 1297987.42 1297987.42 0.00 20236.15 20236.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 30.41 71.31% 7582.34 6954 8491 7589.98 7068 8184 230588 230588 0.00
multistrike 12.24 28.69% 3759.17 3477 4245 3763.17 0 4245 46002 46002 0.00
hit 14.45 29.38% 12113.94 11591 14151 12123.10 11591 13639 175020 175020 0.00
crit 34.73 70.62% 24371.38 23181 28303 24391.24 23332 25877 846378 846378 0.00
 
DPS Timeline Chart
 

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Deals $?a44544[${$m1*$<fingersMult>} to ${$M1*$<fingersMult>}][{$s1=440}] Frost damage to an enemy target{$?s56377=true}&!a44544[, and ${$m1*$56377m2/100} to ${$M1*$56377m2/100} Frost damage to a second nearby target][]{$?s56377=true}&a44544[, and ${$m1*$<fingersMult>*$56377m2/100} to ${$M1*$<fingersMult>*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is doubled against frozen targets. Replaces Fire Blast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
ice_nova 2048 8.5% 13.4 23.09sec 45635 35617 Direct 13.4 30862 62044 35057 13.5% 13.0 9616 19339 13.5%  

Stats details: ice_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.44 13.44 0.00 0.00 1.2813 0.0000 613533.88 613533.88 0.00 35616.74 35616.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.76 13.50% 19338.92 17388 21229 16202.40 0 21229 33984 33984 0.00
multistrike 11.26 86.50% 9616.02 8694 10614 9635.66 8694 10614 108229 108229 0.00
hit 11.64 86.55% 30862.22 28979 35381 30888.68 28979 33247 359109 359109 0.00
crit 1.81 13.45% 62043.81 57959 70762 53116.51 0 70762 112212 112212 0.00
 
DPS Timeline Chart
 

Action details: ice_nova

Static Values
  • id:157997
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2
Spelldata
  • id:157997
  • name:Ice Nova
  • school:frost
  • tooltip:Frozen.
  • description:Causes a whirl of icy wind around the target enemy or ally, dealing {$s2=2199} Frost damage to all enemies within $A2 yards, and freezing for {$d=2 seconds}. A primary enemy target will take {$s1=100}% increased damage. Max 2 charges. Replaces Frost Nova.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
mirror_image 0 (3380) 0.0% (14.1%) 3.0 120.73sec 336268 373092

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.9015 0.0000 0.00 0.00 0.00 373092.47 373092.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.61 86.81% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.40 13.19% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3200.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:
  • description:Creates {$s2=3} copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts {$55342d=40 seconds}.
 
    frostbolt (mirror_image) 9081 14.1% 201.9 4.06sec 5010 3075 Direct 200.9 3326 6757 3907 16.9% 186.9 1026 2097 17.5%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.91 200.90 0.00 0.00 1.6289 0.0000 1011453.69 1011453.69 0.00 3075.38 3075.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 32.62 17.46% 2097.04 1912 2335 2098.49 1930 2295 68397 68397 0.00
multistrike 154.24 82.54% 1025.80 956 1167 1026.49 997 1072 158215 158215 0.00
hit 166.90 83.07% 3325.67 3187 3892 3327.87 3277 3426 555045 555045 0.00
crit 34.01 16.93% 6757.37 6375 7783 6763.69 6375 7314 229796 229796 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - water_elemental 2511 / 2511
water_jet 427 1.8% 10.0 30.37sec 12852 3014 Periodic 39.7 2268 4584 2589 13.9% 31.7 706 1431 14.4% 11.3%

Stats details: water_jet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.99 9.99 39.68 39.68 4.2637 0.8576 128391.23 128391.23 0.00 3014.37 3014.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.6 14.42% 1430.85 1305 1593 1419.83 0 1593 6532 6532 0.00
multistrike 27.1 85.58% 705.75 652 796 706.88 660 772 19117 19117 0.00
hit 34.2 86.14% 2267.85 2174 2655 2269.56 2200 2342 77522 77522 0.00
crit 5.5 13.86% 4584.20 4349 5310 4573.77 0 5310 25221 25221 0.00
 
DPS Timeline Chart
 

Action details: water_jet

Static Values
  • id:135029
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking {$s1=0} damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.282000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
waterbolt 2084 8.7% 114.5 2.61sec 5461 2522 Direct 113.6 3858 7779 4369 13.0% 95.5 1187 2404 13.5%  

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.54 113.61 0.00 0.00 2.1658 0.0000 625497.40 625497.40 0.00 2521.51 2521.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 12.90 13.50% 2403.53 2244 2740 2405.63 2244 2740 31011 31011 0.00
multistrike 82.65 86.50% 1186.88 1122 1370 1187.67 1154 1238 98091 98091 0.00
hit 98.80 86.96% 3857.65 3740 4566 3859.57 3795 3938 381119 381119 0.00
crit 14.82 13.04% 7779.16 7479 9132 7784.56 7479 8660 115276 115276 0.00
 
DPS Timeline Chart
 

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals {$s1=533} Frost damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.485000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - mirror_image 9081 / 3380
frostbolt 9081 14.1% 201.9 4.06sec 5010 3075 Direct 200.9 3326 6757 3907 16.9% 186.9 1026 2097 17.5%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.91 200.90 0.00 0.00 1.6289 0.0000 1011453.69 1011453.69 0.00 3075.38 3075.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 32.62 17.46% 2097.04 1912 2335 2098.49 1930 2295 68397 68397 0.00
multistrike 154.24 82.54% 1025.80 956 1167 1026.49 997 1072 158215 158215 0.00
hit 166.90 83.07% 3325.67 3187 3892 3327.87 3277 3426 555045 555045 0.00
crit 34.01 16.93% 6757.37 6375 7783 6763.69 6375 7314 229796 229796 0.00
 
DPS Timeline Chart
 

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Zentimeter
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
icy_veins 2.1 181.12sec

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 2.06 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.82 88.57% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.24 11.43% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
 
water_elemental 1.0 0.00sec

Stats details: water_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.89 88.95% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.11 11.05% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: water_elemental

Static Values
  • id:31687
  • school:frost
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:4800.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:31687
  • name:Summon Water Elemental
  • school:frost
  • tooltip:
  • description:Summons a Water Elemental to fight for the caster.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
brain_freeze 24.8 5.9 12.0sec 9.6sec 19.92% 100.00% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_brain_freeze
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • brain_freeze_1:19.29%
  • brain_freeze_2:0.63%

Trigger Attempt Success

  • trigger_pct:29.83%

Spelldata details

  • id:57761
  • name:Brain Freeze
  • tooltip:Your next Frostfire Bolt costs no mana, is instant cast, acts as if your target were frozen, and deals {$44549s3=85}% additional damage.
  • description:{$@spelldesc44549=Your Frostbolts have a $m1% chance to cause the Brain Freeze effect. Each multistrike increases that cast's chance by an additional $m2%. The Brain Freeze effect causes your next Frostfire Bolt to cost no mana, be instant cast, deal {$s3=85}% additional damage, and act as if your target were frozen.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
draenic_intellect_potion 2.0 0.0 180.8sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
enhanced_frostbolt 17.5 0.0 17.6sec 18.4sec 7.11% 16.92% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_enhanced_frostbolt
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enhanced_frostbolt_1:7.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157646
  • name:Enhanced Frostbolt
  • tooltip:
  • description:Frostbolt's cast time is reduced by 0.5 sec. This effect is disabled for {$157648d=15 seconds} after you benefit from it.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
fingers_of_frost 35.2 16.3 8.6sec 5.9sec 30.42% 100.00% 1.9(1.9)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • fingers_of_frost_1:26.08%
  • fingers_of_frost_2:4.35%

Trigger Attempt Success

  • trigger_pct:24.62%

Spelldata details

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance or Deep Freeze act as if your target were frozen and Ice Lance deals $w2% more damage.
  • description:{$@spelldesc112965=Your successful Frostbolts, Frostfire Bolts and Frozen Orb hits have a {$s1=15}% chance, and your Blizzard ticks have a {$s2=5}% chance to grant you the Fingers of Frost effect. The Fingers of Frost effect causes your next Ice Lance or Deep Freeze to act as if your target were frozen, and increases Ice Lance damage by {$44544s2=100}%. Limit {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
icy_veins 2.1 0.0 180.8sec 181.2sec 22.63% 24.38% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • icy_veins_1:22.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:$?$w3>0[Multistrike chance increased by $w3%][Haste increased by $w1%] and immune to pushback.
  • description:Accelerates your spellcasting, granting {$?s56364=true}[{$s3=0}% multistrike chance][$m1% haste] and preventing spell pushback.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
mark_of_the_frostwolf 13.6 4.1 22.6sec 17.2sec 31.38% 31.39% 0.9(0.9)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_mark_of_the_frostwolf
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:500.00

Stack Uptimes

  • mark_of_the_frostwolf_1:24.17%
  • mark_of_the_frostwolf_2:7.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159676
  • name:Mark of the Frostwolf
  • tooltip:Multistrike increased by $w1.
  • description:Increases multistrike by {$s1=500}.
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
nightmare_fire 2.9 0.0 121.5sec 121.3sec 18.97% 18.99% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_nightmare_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • nightmare_fire_1:18.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162919
  • name:Nightmare Fire
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
frost_armor

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • frost_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Multistrike increased by $7302w1%. Attackers are slowed.
  • description:Increases multistrike chance by {$s1=8}% and causes enemies who strike the caster to be slowed by {$7321s2=30}% for {$7321d=5 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Zentimeter
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Zentimeter
frostbolt Mana 103.4 661504.7 6400.0 6400.0 2.8
frozen_orb Mana 5.4 86916.0 16000.0 15999.8 2.8
ice_lance Mana 49.3 78950.2 1600.0 1600.0 16.4
mirror_image Mana 3.0 6425.2 2136.1 2136.1 157.4
Resource Gains Type Count Total Average Overflow
external_healing Health 8.15 0.00 (0.00%) 0.00 76111.08 100.00%
mp5_regen Mana 202.56 830220.50 (100.00%) 4098.74 171261.36 17.10%
Resource RPS-Gain RPS-Loss
Mana 2759.13 2771.01
Combat End Resource Mean Min Max
Mana 164441.03 146655.00 168000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
water_elemental 100.0%
water_elemental-water_elemental 100.0%
prismatic_crystal-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
mirror_image-water_elemental 100.0%
Uptimes %
Mana Cap 21.6%
water_elemental-Mana Cap 21.6%
prismatic_crystal-Mana Cap 21.6%
mirror_image-Mana Cap 21.6%
mirror_image-Mana Cap 21.6%
mirror_image-Mana Cap 21.6%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Zentimeter Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Zentimeter Damage Per Second
Count 25000
Mean 23993.41
Minimum 21000.51
Maximum 27557.22
Spread ( max - min ) 6556.70
Range [ ( max - min ) / 2 * 100% ] 13.66%
Standard Deviation 905.5255
5th Percentile 22523.62
95th Percentile 25476.02
( 95th Percentile - 5th Percentile ) 2952.40
Mean Distribution
Standard Deviation 5.7270
95.00% Confidence Intervall ( 23982.18 - 24004.63 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5471
0.1 Scale Factor Error with Delta=300 6999
0.05 Scale Factor Error with Delta=300 27999
0.01 Scale Factor Error with Delta=300 699979
Distribution Chart
DPS(e)
Sample Data Zentimeter Damage Per Second (Effective)
Count 25000
Mean 23993.41
Minimum 21000.51
Maximum 27557.22
Spread ( max - min ) 6556.70
Range [ ( max - min ) / 2 * 100% ] 13.66%
Damage
Sample Data Zentimeter Damage
Count 25000
Mean 5430609.54
Minimum 3914459.12
Maximum 7115108.54
Spread ( max - min ) 3200649.43
Range [ ( max - min ) / 2 * 100% ] 29.47%
DTPS
Sample Data Zentimeter Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zentimeter Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Zentimeter Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zentimeter Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zentimeter Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zentimeter Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ZentimeterTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Zentimeter Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=calamari_crepes
2 0.00 arcane_brilliance
3 0.00 water_elemental
4 0.00 snapshot_stats
5 0.00 rune_of_power
6 0.00 mirror_image
7 0.00 potion,name=draenic_intellect
8 0.00 frostbolt
Default action list Executed every time the actor is available.
# count action,conditions
9 0.00 counterspell,if=target.debuff.casting.react
A 0.00 blink,if=movement.distance>10
B 0.00 blazing_speed,if=movement.remains>0
C 0.00 time_warp,if=target.health.pct<25|time>5
D 2.01 mirror_image
E 0.00 ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
F 0.00 rune_of_power,if=buff.rune_of_power.remains<cast_time
G 0.00 rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
H 0.00 call_action_list,name=cooldowns,if=time_to_die<24
I 0.00 call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
J 0.00 call_action_list,name=aoe,if=active_enemies>=4
K 0.00 call_action_list,name=single_target
actions.cooldowns
# count action,conditions
X 2.06 icy_veins
Consolidated damage cooldown abilities
Y 0.00 blood_fury
Z 0.00 berserking
a 0.00 arcane_torrent
b 1.00 potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up
actions.single_target
# count action,conditions
j 0.00 call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
Single target sequence
k 0.00 ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
Safeguards against losing FoF and BF to buff expiry
l 0.00 frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
m 0.00 frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
Frozen Orb usage without Prismatic Crystal
n 5.43 frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
o 0.00 frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
p 1.17 ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
q 21.96 ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
r 0.00 comet_storm
s 12.27 ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
t 30.41 frostfire_bolt,if=buff.brain_freeze.react
u 0.00 ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
v 0.00 ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
w 0.00 frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
Camp procs and spam Frostbolt while 4T17 buff is up
x 27.38 ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
y 10.01 water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
z 102.91 frostbolt
{ 0.00 ice_lance,moving=1

Sample Sequence

013678XnpqqqszzzttyzxzxzzzxtxzzstzztzztzzxyzztqxzzzszzzznqqttzzttyzzsxxzzttxzzzztqxyzzstqxzzzxtzzzDqnqqszqqqxyzzxzxzzttzszztxzzyzxxzztzzzzzXbstknqzqtqzztqtqsxyzzqtqxzzttzzzzstzyzzxxzzzDznqzzstzxyzztqxzzxzzxzszzzzyzxtq

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 168000.0/168000: 100% mana
Pre food Fluffy_Pillow 168000.0/168000: 100% mana
Pre water_elemental Fluffy_Pillow 168000.0/168000: 100% mana
Pre mirror_image Fluffy_Pillow 168000.0/168000: 100% mana
Pre potion Fluffy_Pillow 168000.0/168000: 100% mana draenic_intellect_potion
0:00.000 frostbolt Fluffy_Pillow 161600.0/168000: 96% mana fingers_of_frost, mark_of_the_frostwolf, draenic_intellect_potion
0:00.000 icy_veins Fluffy_Pillow 161600.0/168000: 96% mana fingers_of_frost, mark_of_the_frostwolf, draenic_intellect_potion
0:00.000 frozen_orb Fluffy_Pillow 161600.0/168000: 96% mana fingers_of_frost, icy_veins, mark_of_the_frostwolf, draenic_intellect_potion
0:01.351 ice_nova Fluffy_Pillow 151232.9/168000: 90% mana bloodlust, fingers_of_frost(2), icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:02.391 ice_lance Fluffy_Pillow 155569.1/168000: 93% mana bloodlust, fingers_of_frost(2), icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:03.431 ice_lance Fluffy_Pillow 158305.3/168000: 94% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:04.472 ice_lance Fluffy_Pillow 161045.7/168000: 96% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:05.512 ice_nova Fluffy_Pillow 163781.9/168000: 97% mana bloodlust, icy_veins, nightmare_fire, mark_of_the_frostwolf, draenic_intellect_potion
0:06.552 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins, enhanced_frostbolt, nightmare_fire, draenic_intellect_potion
0:07.592 frostbolt Fluffy_Pillow 165936.2/168000: 99% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:08.978 frostbolt Fluffy_Pillow 165315.0/168000: 98% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, draenic_intellect_potion
0:10.363 frostfire_bolt Fluffy_Pillow 164689.7/168000: 98% mana bloodlust, brain_freeze(2), icy_veins, nightmare_fire, draenic_intellect_potion
0:11.402 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, icy_veins, nightmare_fire, draenic_intellect_potion
0:12.442 water_jet Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:12.442 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:13.827 ice_lance Fluffy_Pillow 167374.7/168000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:14.868 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:16.253 ice_lance Fluffy_Pillow 167374.7/168000: 100% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, draenic_intellect_potion
0:17.293 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:18.679 frostbolt Fluffy_Pillow 167378.8/168000: 100% mana bloodlust, icy_veins, nightmare_fire, draenic_intellect_potion
0:20.065 frostbolt Fluffy_Pillow 166757.7/168000: 99% mana bloodlust, fingers_of_frost, icy_veins, nightmare_fire, mark_of_the_frostwolf
0:21.451 ice_lance Fluffy_Pillow 166136.5/168000: 99% mana bloodlust, brain_freeze, fingers_of_frost, icy_veins, mark_of_the_frostwolf
0:22.491 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, icy_veins, mark_of_the_frostwolf
0:23.533 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, fingers_of_frost, icy_veins, mark_of_the_frostwolf
0:24.574 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins, enhanced_frostbolt, mark_of_the_frostwolf
0:25.614 frostbolt Fluffy_Pillow 165936.2/168000: 99% mana bloodlust, icy_veins, mark_of_the_frostwolf
0:27.001 ice_nova Fluffy_Pillow 165319.2/168000: 98% mana bloodlust, brain_freeze, icy_veins
0:28.043 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, brain_freeze, icy_veins
0:29.083 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins
0:30.469 frostbolt Fluffy_Pillow 167378.8/168000: 100% mana bloodlust, brain_freeze, icy_veins
0:31.853 frostfire_bolt Fluffy_Pillow 166749.3/168000: 99% mana bloodlust, brain_freeze, icy_veins
0:32.893 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, icy_veins
0:34.279 frostbolt Fluffy_Pillow 167378.8/168000: 100% mana bloodlust, brain_freeze
0:35.665 frostfire_bolt Fluffy_Pillow 166757.7/168000: 99% mana bloodlust, brain_freeze
0:36.708 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust
0:38.095 frostbolt Fluffy_Pillow 167383.0/168000: 100% mana bloodlust, fingers_of_frost, mark_of_the_frostwolf
0:39.480 ice_lance Fluffy_Pillow 166757.7/168000: 99% mana bloodlust, fingers_of_frost, mark_of_the_frostwolf
0:40.519 water_jet Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, mark_of_the_frostwolf
0:40.519 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana bloodlust, mark_of_the_frostwolf
0:41.906 frostbolt Fluffy_Pillow 166048.5/168000: 99% mana brain_freeze, enhanced_frostbolt, mark_of_the_frostwolf
0:43.259 frostfire_bolt Fluffy_Pillow 163987.9/168000: 98% mana brain_freeze, fingers_of_frost, mark_of_the_frostwolf
0:44.610 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2)
0:45.962 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
0:47.312 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
0:49.112 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana
0:50.912 frostbolt Fluffy_Pillow 166746.1/168000: 99% mana mark_of_the_frostwolf
0:52.711 ice_nova Fluffy_Pillow 166116.0/168000: 99% mana mark_of_the_frostwolf
0:54.063 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana mark_of_the_frostwolf
0:55.861 frostbolt Fluffy_Pillow 167366.6/168000: 100% mana mark_of_the_frostwolf
0:57.661 frostbolt Fluffy_Pillow 166739.7/168000: 99% mana
0:59.459 frostbolt Fluffy_Pillow 166106.4/168000: 99% mana brain_freeze, fingers_of_frost, enhanced_frostbolt
1:00.810 frozen_orb Fluffy_Pillow 164039.4/168000: 98% mana brain_freeze(2), fingers_of_frost
1:02.161 ice_lance Fluffy_Pillow 152372.4/168000: 91% mana brain_freeze(2), fingers_of_frost(2), mark_of_the_frostwolf
1:03.512 ice_lance Fluffy_Pillow 155105.4/168000: 92% mana brain_freeze(2), fingers_of_frost, mark_of_the_frostwolf
1:04.862 frostfire_bolt Fluffy_Pillow 157835.2/168000: 94% mana brain_freeze(2), mark_of_the_frostwolf(2)
1:06.213 frostfire_bolt Fluffy_Pillow 162168.2/168000: 97% mana brain_freeze, mark_of_the_frostwolf(2)
1:07.562 frostbolt Fluffy_Pillow 166494.8/168000: 99% mana mark_of_the_frostwolf(2)
1:09.361 frostbolt Fluffy_Pillow 165864.6/168000: 99% mana brain_freeze, mark_of_the_frostwolf(2)
1:11.160 frostfire_bolt Fluffy_Pillow 165234.5/168000: 98% mana brain_freeze(2)
1:12.509 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze
1:13.860 water_jet Fluffy_Pillow 168000.0/168000: 100% mana
1:13.860 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
1:15.660 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana
1:17.460 ice_nova Fluffy_Pillow 166746.1/168000: 99% mana fingers_of_frost, mark_of_the_frostwolf
1:18.811 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2), mark_of_the_frostwolf
1:20.161 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, mark_of_the_frostwolf
1:21.511 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt, mark_of_the_frostwolf
1:22.861 frostbolt Fluffy_Pillow 165929.8/168000: 99% mana brain_freeze, mark_of_the_frostwolf(2)
1:24.661 frostfire_bolt Fluffy_Pillow 165302.9/168000: 98% mana brain_freeze(2), mark_of_the_frostwolf(2)
1:26.012 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, mark_of_the_frostwolf(2)
1:27.359 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, mark_of_the_frostwolf(2)
1:28.710 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana mark_of_the_frostwolf(2)
1:30.509 frostbolt Fluffy_Pillow 167369.9/168000: 100% mana mark_of_the_frostwolf
1:32.308 frostbolt Fluffy_Pillow 166739.7/168000: 99% mana mark_of_the_frostwolf
1:34.109 frostbolt Fluffy_Pillow 166116.0/168000: 99% mana brain_freeze, fingers_of_frost, mark_of_the_frostwolf
1:35.908 frostfire_bolt Fluffy_Pillow 165485.8/168000: 99% mana brain_freeze, fingers_of_frost(2), mark_of_the_frostwolf(2)
1:37.257 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2), mark_of_the_frostwolf(2)
1:38.606 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, mark_of_the_frostwolf(2)
1:39.957 water_jet Fluffy_Pillow 168000.0/168000: 100% mana mark_of_the_frostwolf(2)
1:39.957 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt, mark_of_the_frostwolf(2)
1:41.306 frostbolt Fluffy_Pillow 165926.6/168000: 99% mana brain_freeze, mark_of_the_frostwolf(2)
1:43.104 ice_nova Fluffy_Pillow 165293.2/168000: 98% mana brain_freeze, fingers_of_frost
1:44.453 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost(2)
1:45.803 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2)
1:47.153 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
1:48.503 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
1:50.302 frostbolt Fluffy_Pillow 167369.9/168000: 100% mana mark_of_the_frostwolf
1:52.101 frostbolt Fluffy_Pillow 166739.7/168000: 99% mana fingers_of_frost, mark_of_the_frostwolf
1:53.902 ice_lance Fluffy_Pillow 166116.0/168000: 99% mana brain_freeze, fingers_of_frost, mark_of_the_frostwolf
1:55.252 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, mark_of_the_frostwolf
1:56.604 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt
1:57.954 frostbolt Fluffy_Pillow 165929.8/168000: 99% mana
1:59.754 frostbolt Fluffy_Pillow 165302.9/168000: 98% mana fingers_of_frost, nightmare_fire
2:01.552 mirror_image Fluffy_Pillow 164669.5/168000: 98% mana fingers_of_frost(2), nightmare_fire
2:02.904 ice_lance Fluffy_Pillow 165805.7/168000: 99% mana fingers_of_frost(2), nightmare_fire
2:04.254 frozen_orb Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, nightmare_fire
2:05.604 ice_lance Fluffy_Pillow 156329.8/168000: 93% mana fingers_of_frost(2), nightmare_fire
2:06.955 ice_lance Fluffy_Pillow 159062.8/168000: 95% mana fingers_of_frost, nightmare_fire
2:08.306 ice_nova Fluffy_Pillow 161795.8/168000: 96% mana nightmare_fire
2:09.657 frostbolt Fluffy_Pillow 166128.8/168000: 99% mana fingers_of_frost, nightmare_fire
2:11.457 ice_lance Fluffy_Pillow 165501.9/168000: 99% mana fingers_of_frost(2), nightmare_fire
2:12.809 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2), nightmare_fire
2:14.159 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2), nightmare_fire
2:15.510 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, nightmare_fire
2:16.862 water_jet Fluffy_Pillow 168000.0/168000: 100% mana nightmare_fire, mark_of_the_frostwolf
2:16.862 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt, nightmare_fire, mark_of_the_frostwolf
2:18.212 frostbolt Fluffy_Pillow 165929.8/168000: 99% mana nightmare_fire, mark_of_the_frostwolf
2:20.012 ice_lance Fluffy_Pillow 165302.9/168000: 98% mana fingers_of_frost, mark_of_the_frostwolf
2:21.361 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, mark_of_the_frostwolf
2:23.160 ice_lance Fluffy_Pillow 167369.9/168000: 100% mana fingers_of_frost, mark_of_the_frostwolf
2:24.512 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana mark_of_the_frostwolf
2:26.312 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana brain_freeze, mark_of_the_frostwolf
2:28.111 frostfire_bolt Fluffy_Pillow 166742.9/168000: 99% mana brain_freeze(2), mark_of_the_frostwolf
2:29.461 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze
2:30.811 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
2:32.611 ice_nova Fluffy_Pillow 167373.1/168000: 100% mana
2:33.961 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt
2:35.311 frostbolt Fluffy_Pillow 165929.8/168000: 99% mana brain_freeze
2:37.111 frostfire_bolt Fluffy_Pillow 165302.9/168000: 98% mana brain_freeze
2:38.462 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost
2:39.812 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
2:41.611 frostbolt Fluffy_Pillow 167369.9/168000: 100% mana
2:43.412 water_jet Fluffy_Pillow 166746.1/168000: 99% mana fingers_of_frost, mark_of_the_frostwolf
2:43.412 frostbolt Fluffy_Pillow 166746.1/168000: 99% mana fingers_of_frost, mark_of_the_frostwolf
2:45.213 ice_lance Fluffy_Pillow 166122.4/168000: 99% mana fingers_of_frost, mark_of_the_frostwolf
2:46.561 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, mark_of_the_frostwolf
2:47.912 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana mark_of_the_frostwolf
2:49.711 frostbolt Fluffy_Pillow 167369.9/168000: 100% mana brain_freeze, fingers_of_frost
2:51.510 frostfire_bolt Fluffy_Pillow 166739.7/168000: 99% mana brain_freeze, fingers_of_frost
2:52.861 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, enhanced_frostbolt
2:54.214 frostbolt Fluffy_Pillow 165939.4/168000: 99% mana fingers_of_frost
2:56.013 frostbolt Fluffy_Pillow 165309.3/168000: 98% mana fingers_of_frost
2:57.813 frostbolt Fluffy_Pillow 164682.3/168000: 98% mana fingers_of_frost
2:59.612 frostbolt Fluffy_Pillow 164052.2/168000: 98% mana fingers_of_frost
3:01.410 icy_veins Fluffy_Pillow 163418.8/168000: 97% mana brain_freeze, fingers_of_frost
3:01.410 potion Fluffy_Pillow 163418.8/168000: 97% mana brain_freeze, fingers_of_frost, icy_veins
3:01.410 ice_nova Fluffy_Pillow 163418.8/168000: 97% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:02.761 frostfire_bolt Fluffy_Pillow 167751.8/168000: 100% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:04.113 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:05.463 frozen_orb Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, draenic_intellect_potion
3:06.814 ice_lance Fluffy_Pillow 156333.0/168000: 93% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:08.167 frostbolt Fluffy_Pillow 159072.4/168000: 95% mana icy_veins, draenic_intellect_potion
3:09.967 ice_lance Fluffy_Pillow 158445.5/168000: 94% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:11.318 frostfire_bolt Fluffy_Pillow 161178.5/168000: 96% mana brain_freeze, icy_veins, draenic_intellect_potion
3:12.668 ice_lance Fluffy_Pillow 165508.3/168000: 99% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:14.017 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, enhanced_frostbolt, draenic_intellect_potion
3:15.367 frostbolt Fluffy_Pillow 165929.8/168000: 99% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:17.165 frostfire_bolt Fluffy_Pillow 165296.4/168000: 98% mana brain_freeze(2), fingers_of_frost, icy_veins, draenic_intellect_potion
3:18.515 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost(2), icy_veins, draenic_intellect_potion
3:19.866 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost, icy_veins, draenic_intellect_potion
3:21.216 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2), icy_veins, draenic_intellect_potion
3:22.567 ice_nova Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:23.918 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, icy_veins, draenic_intellect_potion
3:25.268 water_jet Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, draenic_intellect_potion
3:25.268 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, draenic_intellect_potion
3:27.067 frostbolt Fluffy_Pillow 167369.9/168000: 100% mana brain_freeze, fingers_of_frost, icy_veins, mark_of_the_frostwolf
3:28.870 ice_lance Fluffy_Pillow 166752.5/168000: 99% mana brain_freeze, fingers_of_frost(2), icy_veins, mark_of_the_frostwolf(2)
3:30.220 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, fingers_of_frost(2), icy_veins, mark_of_the_frostwolf(2)
3:31.571 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2), icy_veins, mark_of_the_frostwolf(2)
3:32.922 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, icy_veins, mark_of_the_frostwolf(2)
3:34.274 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana icy_veins, enhanced_frostbolt, mark_of_the_frostwolf(2)
3:35.623 frostbolt Fluffy_Pillow 165926.6/168000: 99% mana brain_freeze, icy_veins, mark_of_the_frostwolf(2)
3:37.423 frostfire_bolt Fluffy_Pillow 165299.7/168000: 98% mana brain_freeze(2), icy_veins, mark_of_the_frostwolf(2)
3:38.772 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze, icy_veins
3:40.123 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana icy_veins
3:41.922 frostbolt Fluffy_Pillow 167369.9/168000: 100% mana mark_of_the_frostwolf
3:43.722 frostbolt Fluffy_Pillow 166742.9/168000: 99% mana mark_of_the_frostwolf
3:45.521 frostbolt Fluffy_Pillow 166112.8/168000: 99% mana brain_freeze, mark_of_the_frostwolf
3:47.323 ice_nova Fluffy_Pillow 165492.3/168000: 99% mana brain_freeze, mark_of_the_frostwolf
3:48.673 frostfire_bolt Fluffy_Pillow 168000.0/168000: 100% mana brain_freeze
3:50.022 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
3:51.821 water_jet Fluffy_Pillow 167369.9/168000: 100% mana
3:51.821 frostbolt Fluffy_Pillow 167369.9/168000: 100% mana enhanced_frostbolt
3:53.171 frostbolt Fluffy_Pillow 165299.7/168000: 98% mana
3:54.970 ice_lance Fluffy_Pillow 164669.5/168000: 98% mana fingers_of_frost
3:56.322 ice_lance Fluffy_Pillow 167405.7/168000: 100% mana fingers_of_frost
3:57.672 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
3:59.472 frostbolt Fluffy_Pillow 167373.1/168000: 100% mana
4:01.270 frostbolt Fluffy_Pillow 166739.7/168000: 99% mana
4:03.070 mirror_image Fluffy_Pillow 166112.8/168000: 99% mana
4:04.422 frostbolt Fluffy_Pillow 167249.0/168000: 100% mana
4:06.223 frozen_orb Fluffy_Pillow 166625.3/168000: 99% mana nightmare_fire
4:07.574 ice_lance Fluffy_Pillow 154958.3/168000: 92% mana fingers_of_frost, nightmare_fire
4:08.924 frostbolt Fluffy_Pillow 157688.1/168000: 94% mana enhanced_frostbolt, nightmare_fire
4:10.275 frostbolt Fluffy_Pillow 155621.1/168000: 93% mana brain_freeze, nightmare_fire
4:12.074 ice_nova Fluffy_Pillow 154990.9/168000: 92% mana brain_freeze, nightmare_fire
4:13.424 frostfire_bolt Fluffy_Pillow 159320.7/168000: 95% mana brain_freeze, nightmare_fire
4:14.774 frostbolt Fluffy_Pillow 163650.5/168000: 97% mana nightmare_fire
4:16.574 ice_lance Fluffy_Pillow 163023.6/168000: 97% mana fingers_of_frost, nightmare_fire, mark_of_the_frostwolf
4:17.923 water_jet Fluffy_Pillow 165750.2/168000: 99% mana nightmare_fire, mark_of_the_frostwolf
4:17.923 frostbolt Fluffy_Pillow 165750.2/168000: 99% mana nightmare_fire, mark_of_the_frostwolf
4:19.724 frostbolt Fluffy_Pillow 165126.4/168000: 98% mana brain_freeze, nightmare_fire, mark_of_the_frostwolf
4:21.524 frostfire_bolt Fluffy_Pillow 164499.5/168000: 98% mana brain_freeze, fingers_of_frost, nightmare_fire, mark_of_the_frostwolf(2)
4:22.875 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2), nightmare_fire, mark_of_the_frostwolf(2)
4:24.226 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost, nightmare_fire, mark_of_the_frostwolf(2)
4:25.578 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana enhanced_frostbolt, nightmare_fire, mark_of_the_frostwolf(2)
4:26.929 frostbolt Fluffy_Pillow 165933.0/168000: 99% mana fingers_of_frost, mark_of_the_frostwolf(2)
4:28.728 ice_lance Fluffy_Pillow 165302.9/168000: 98% mana fingers_of_frost
4:30.078 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:31.879 frostbolt Fluffy_Pillow 167376.3/168000: 100% mana fingers_of_frost
4:33.679 ice_lance Fluffy_Pillow 166749.3/168000: 99% mana fingers_of_frost
4:35.030 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:36.829 ice_nova Fluffy_Pillow 167369.9/168000: 100% mana
4:38.179 frostbolt Fluffy_Pillow 168000.0/168000: 100% mana
4:39.980 frostbolt Fluffy_Pillow 167376.3/168000: 100% mana
4:41.780 frostbolt Fluffy_Pillow 166749.3/168000: 99% mana
4:43.579 frostbolt Fluffy_Pillow 166119.2/168000: 99% mana fingers_of_frost, enhanced_frostbolt
4:44.929 water_jet Fluffy_Pillow 164049.0/168000: 98% mana fingers_of_frost
4:44.929 frostbolt Fluffy_Pillow 164049.0/168000: 98% mana fingers_of_frost
4:46.729 ice_lance Fluffy_Pillow 163422.1/168000: 97% mana brain_freeze, fingers_of_frost
4:48.081 frostfire_bolt Fluffy_Pillow 166158.3/168000: 99% mana brain_freeze, fingers_of_frost
4:49.431 ice_lance Fluffy_Pillow 168000.0/168000: 100% mana fingers_of_frost(2), mark_of_the_frostwolf

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 674 642 642
Agility 935 891 891
Stamina 4110 3737 3737
Intellect 3889 3441 3330 (2233)
Spirit 1155 1155 1155
Health 246600 224220 0
Mana 168000 168000 0
Spell Power 5487 4540 1099
Crit 13.66% 8.66% 403
Haste 11.36% 6.06% 501
Multistrike 27.82% 13.23% 873
Damage / Heal Versatility 5.62% 2.62% 341
ManaReg per Second 3207 3055 0
Mastery 41.92% 31.92% 876
Armor 606 606 606

Talents

Level
15 Evanesce Blazing Speed Ice Floes
30 Alter Time Flameglow Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Frost Bomb (Frost Mage) Unstable Magic Ice Nova (Frost Mage)
90 Mirror Image Rune of Power Incanter's Flow
100 Thermal Void (Frost Mage) Prismatic Crystal Comet Storm (Frost Mage)

Profile

mage="Zentimeter"
origin="http://eu.battle.net/wow/en/character/forscherliga/Zentimeter/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/110/70512494-avatar.jpg"
level=100
race=gnome
role=spell
position=back
professions=tailoring=685/enchanting=675
talents=http://eu.battle.net/wow/en/tool/talent-calculator#eb!2201200
glyphs=icy_veins/splitting_ice/water_elemental/conjure_familiar/evaporation/momentum
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/arcane_brilliance
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/rune_of_power
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/frostbolt

# Executed every time the actor is available.

actions=counterspell,if=target.debuff.casting.react
actions+=/blink,if=movement.distance>10
actions+=/blazing_speed,if=movement.remains>0
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/mirror_image
actions+=/ice_floes,if=buff.ice_floes.down&(raid_event.movement.distance>0|raid_event.movement.in<action.frostbolt.cast_time)
actions+=/rune_of_power,if=buff.rune_of_power.remains<cast_time
actions+=/rune_of_power,if=(cooldown.icy_veins.remains<gcd.max&buff.rune_of_power.remains<20)|(cooldown.prismatic_crystal.remains<gcd.max&buff.rune_of_power.remains<10)
actions+=/call_action_list,name=cooldowns,if=time_to_die<24
actions+=/call_action_list,name=crystal_sequence,if=talent.prismatic_crystal.enabled&(cooldown.prismatic_crystal.remains<=gcd.max|pet.prismatic_crystal.active)
actions+=/call_action_list,name=aoe,if=active_enemies>=4
actions+=/call_action_list,name=single_target

# Actions while Prismatic Crystal is active
actions.crystal_sequence=frost_bomb,if=active_enemies=1&current_target!=prismatic_crystal&remains<10
actions.crystal_sequence+=/frozen_orb
actions.crystal_sequence+=/call_action_list,name=cooldowns
actions.crystal_sequence+=/prismatic_crystal
actions.crystal_sequence+=/frost_bomb,if=talent.prismatic_crystal.enabled&current_target=prismatic_crystal&active_enemies>1&!ticking
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&active_dot.frozen_orb>=1)
actions.crystal_sequence+=/ice_nova,if=charges=2
actions.crystal_sequence+=/frostfire_bolt,if=buff.brain_freeze.react
actions.crystal_sequence+=/ice_lance,if=buff.fingers_of_frost.react
actions.crystal_sequence+=/ice_nova
actions.crystal_sequence+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2),if=active_enemies>=5
actions.crystal_sequence+=/frostbolt

# Consolidated damage cooldown abilities
actions.cooldowns=icy_veins
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=draenic_intellect,if=buff.bloodlust.up|buff.icy_veins.up

# AoE sequence
actions.aoe=call_action_list,name=cooldowns
actions.aoe+=/frost_bomb,if=remains<action.ice_lance.travel_time&(cooldown.frozen_orb.remains<gcd.max|buff.fingers_of_frost.react=2)
actions.aoe+=/frozen_orb
actions.aoe+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.up
actions.aoe+=/comet_storm
actions.aoe+=/ice_nova
actions.aoe+=/blizzard,interrupt_if=cooldown.frozen_orb.up|(talent.frost_bomb.enabled&buff.fingers_of_frost.react=2)

# Single target sequence
actions.single_target=call_action_list,name=cooldowns,if=!talent.prismatic_crystal.enabled|cooldown.prismatic_crystal.remains>15
# Safeguards against losing FoF and BF to buff expiry
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react&buff.fingers_of_frost.remains<action.frostbolt.execute_time
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react&buff.brain_freeze.remains<action.frostbolt.execute_time
# Frozen Orb usage without Prismatic Crystal
actions.single_target+=/frost_bomb,if=!talent.prismatic_crystal.enabled&cooldown.frozen_orb.remains<gcd.max&debuff.frost_bomb.remains<10
actions.single_target+=/frozen_orb,if=!talent.prismatic_crystal.enabled&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains>45
# Single target routine; Rough summary: IN2 > FoF2 > CmS > IN > BF > FoF
actions.single_target+=/frost_bomb,if=remains<action.ice_lance.travel_time&(buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&(talent.thermal_void.enabled|buff.fingers_of_frost.remains<gcd.max*2)))
actions.single_target+=/ice_nova,if=time_to_die<10|(charges=2&(!talent.prismatic_crystal.enabled|!cooldown.prismatic_crystal.up))
actions.single_target+=/ice_lance,if=buff.fingers_of_frost.react=2|(buff.fingers_of_frost.react&dot.frozen_orb.ticking)
actions.single_target+=/comet_storm
actions.single_target+=/ice_nova,if=(!talent.prismatic_crystal.enabled|(charges=1&cooldown.prismatic_crystal.remains>recharge_time&buff.incanters_flow.stack>3))&(buff.icy_veins.up|(charges=1&cooldown.icy_veins.remains>recharge_time))
actions.single_target+=/frostfire_bolt,if=buff.brain_freeze.react
actions.single_target+=/ice_lance,if=set_bonus.tier17_4pc&talent.thermal_void.enabled&talent.mirror_image.enabled&dot.frozen_orb.ticking
actions.single_target+=/ice_lance,if=talent.frost_bomb.enabled&buff.fingers_of_frost.react&debuff.frost_bomb.remains>travel_time&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
# Camp procs and spam Frostbolt while 4T17 buff is up
actions.single_target+=/frostbolt,if=set_bonus.tier17_2pc&buff.ice_shard.up&!(talent.thermal_void.enabled&buff.icy_veins.up&buff.icy_veins.remains<10)
actions.single_target+=/ice_lance,if=!talent.frost_bomb.enabled&buff.fingers_of_frost.react&(!talent.thermal_void.enabled|cooldown.icy_veins.remains>8)
actions.single_target+=/water_jet,if=buff.fingers_of_frost.react=0&!dot.frozen_orb.ticking
actions.single_target+=/frostbolt
actions.single_target+=/ice_lance,moving=1

head=vilebreath_mask,id=113596
neck=cratermaker_choker,id=116285,enchant=75mult
shoulders=slaughterhouse_spaulders,id=113609
back=kyusys_tarflame_doomcloak,id=119346,enchant=gift_of_multistrike
chest=hexweave_robe,id=114813,bonus_id=195/525/538
tabard=stormwind_tabard,id=118365
wrists=crystalwoven_bracers,id=113642
hands=sterilized_handwraps,id=115998,bonus_id=563,gems=35mult
waist=hexweave_belt,id=114816,bonus_id=184/525/538
legs=trousers_of_arcane_mystery,id=109804,bonus_id=524
feet=felflame_sandals,id=109797,bonus_id=524
finger1=diamondglow_circle,id=109763,bonus_id=524,enchant=30mult
finger2=timeless_solium_band_of_the_archmage,id=118296,enchant=50mult
trinket1=sandmans_pouch,id=112320,bonus_id=525/530
trinket2=tovras_lightning_repository,id=110001,bonus_id=524
main_hand=grandiose_spire,id=115333,bonus_id=102/563,gems=35mult,enchant=mark_of_the_frostwolf

# Gear Summary
# gear_stamina=2847
# gear_intellect=2233
# gear_spell_power=1099
# gear_crit_rating=403
# gear_haste_rating=501
# gear_mastery_rating=876
# gear_armor=606
# gear_multistrike_rating=831
# gear_versatility_rating=341

Zambo

Zambo : 26178 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
26177.5 26177.5 11.6 / 0.044% 3649.4 / 13.9% 76.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
341.8 341.8 Mana 1.61% 47.5 100.0% 100%
Origin http://eu.battle.net/wow/en/character/dalvengyr/Zambo/advanced
Talents
  • 15: Pursuit of Justice
  • 30: Fist of Justice
  • 45: Selfless Healer
  • 60: Unbreakable Spirit
  • 75: Divine Purpose
  • 90: Execution Sentence
  • 100: Final Verdict (Retribution Paladin)
  • Talent Calculator
Glyphs
  • Glyph of Divine Storm
  • Glyph of Templar's Verdict
  • Glyph of Double Jeopardy
  • Glyph of Bladed Judgment
  • Glyph of Fire From the Heavens
  • Glyph of Winged Vengeance
Professions
  • mining: 700
  • blacksmithing: 700

Charts

http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Zambo+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:52434|20469|19837|15722|9183|9108|6587|2488&chds=0,104867&chco=FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,C79C6E&chm=t++52434++execution_sentence,FFE57F,0,0,15|t++20469++final_verdict,FFE57F,1,0,15|t++19837++divine_storm,FFE57F,2,0,15|t++15722++hammer_of_wrath,FFE57F,3,0,15|t++9183++judgment,FFE57F,4,0,15|t++9108++exorcism,FFE57F,5,0,15|t++6587++crusader_strike,C79C6E,6,0,15|t++2488++melee,C79C6E,7,0,15& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zambo+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:26,22,9,8,7,7,6,5,5,3,2,1&chds=0,100&chdls=ffffff&chco=FFE57F,FFE57F,C79C6E,FFE57F,C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,FFE57F&chl=hand_of_light|final_verdict|melee|hammer_of_wrath|crusader_strike|divine_storm|judgment|seal_of_truth_proc|execution_sentence|censure|shattered_bleed|exorcism&
http://7.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Zambo+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:gimosuw0368656310zxvrrpomlljigfgfffededccccbbaaaZZYYXYYYZZZabbbbbbcbbbccdcbcbbbbZYZZZZYZZYYZYYZYYZYYYZYYZYYZYYZXYabcefghkmmopprrsuuwxutsrqpomjjhggeedcbbZaaZZaZZZaZZaaaaaaaZYZZZaaaabbddddeddedeffffeeeeddcccccccccdccdccddccdddddddddddcccdeeefgghjjjkkklllnnmnmllljjigggfffeeedddddddddddddddddddddcbbccccdddffffffffffgghggggfffdddddddddcddccddccddcdcddccdcccbbbcbbbbZYWVUSRPOM&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.533937,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=26178|max=49027&chxp=1,1,53,100 http://0.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Zambo+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,2,4,13,20,58,79,129,201,299,401,536,733,871,1116,1281,1429,1489,1651,1640,1611,1677,1506,1407,1270,1060,924,794,608,535,435,334,267,182,129,110,73,40,28,22,12,11,2,3,1,3,0,0,1,1&chds=0,1677&chbh=5&chxt=x&chxl=0:|min=22987|avg=26178|max=30745&chxp=0,1,41,100& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Zambo+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:28.3,26.2,16.6,12.7,8.6,3.9,2.4,1.6&chds=0,100&chdls=ffffff&chco=FFE57F,C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,ffffff&chl=final_verdict 85.1s|crusader_strike 78.8s|judgment 49.8s|hammer_of_wrath 38.2s|divine_storm 25.9s|exorcism 11.7s|execution_sentence 7.2s|waiting 4.8s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Zambo 26178
censure 738 2.8% 297.0 1.01sec 747 0 Periodic 99.4 1831 3679 2073 13.1% 25.7 549 1104 13.1% 99.1%

Stats details: censure

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 297.02 297.02 99.36 99.36 0.0000 3.0000 221962.49 221962.49 0.00 744.61 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 297.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.4 13.14% 1103.67 1025 1516 1061.59 0 1516 3730 3730 0.00
multistrike 22.3 86.86% 549.34 512 758 549.81 512 660 12274 12274 0.00
hit 86.4 86.92% 1831.13 1708 2526 1832.62 1772 1888 158149 158149 0.00
crit 13.0 13.08% 3678.56 3415 5053 3681.68 3415 4640 47810 47810 0.00
 
DPS Timeline Chart
 

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31803
  • name:Censure
  • school:holy
  • tooltip:Holy damage every $t1 sec.
  • description:Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.061776
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
crusader_strike 1726 6.6% 62.1 4.82sec 8355 6587 Direct 62.1 6851 13770 7752 13.0% 16.1 2056 4129 13.1%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.14 62.14 0.00 0.00 1.2684 0.0000 519208.06 797940.81 34.93 6587.26 6587.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.11 13.10% 4128.53 3869 5496 3621.97 0 5496 8709 13385 30.64
multistrike 14.00 86.90% 2055.83 1935 2748 2057.15 1935 2585 28774 44221 34.93
hit 54.05 86.98% 6851.45 6449 9160 6856.03 6522 7181 370352 569173 34.93
crit 8.09 13.02% 13770.19 12897 18320 13780.28 0 18320 111372 171162 34.92
 
DPS Timeline Chart
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:640.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<5
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:{$?s85673=true}|s85256[An instant strike that causes $sw2 Physical damage and grants 1 Holy Power.][An instant strike that causes $sw2 Physical damage.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
divine_storm 1711 6.5% 20.3 14.00sec 25299 19837 Direct 20.3 20778 41656 23467 12.9% 5.3 6233 12513 12.9%  

Stats details: divine_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.32 20.32 0.00 0.00 1.2754 0.0000 514088.62 514088.62 0.00 19836.73 19836.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.68 12.91% 12513.46 11595 16471 6118.19 0 16471 8543 8543 0.00
multistrike 4.60 87.09% 6232.67 5798 8235 6133.51 0 8235 28691 28691 0.00
hit 17.70 87.12% 20777.86 19326 27451 20796.50 19326 25172 367841 367841 0.00
crit 2.62 12.88% 41656.41 38651 54902 38445.60 0 54902 109014 109014 0.00
 
DPS Timeline Chart
 

Action details: divine_storm

Static Values
  • id:53385
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
Spelldata
  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Deals $sw1 Holy damage to all enemies within $A1 yards. {$?s63220=true}[Using Divine Storm will also heal you for {$115515s1=4}% of your maximum health.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.78
 
execution_sentence 1261 4.8% 5.5 60.78sec 69282 52434 Periodic 53.4 5721 11862 6561 13.7% 13.9 1715 3569 13.7% 17.8%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.46 5.46 53.44 53.44 1.3215 1.0000 377993.55 377993.55 0.00 6232.27 52433.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.46 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.9 13.72% 3569.41 1135 19790 2992.09 0 19790 6797 6797 0.00
multistrike 12.0 86.28% 1715.12 567 9895 1717.56 661 5938 20544 20544 0.00
hit 46.1 86.31% 5720.74 1891 32984 5727.66 3400 7133 263879 263879 0.00
crit 7.3 13.69% 11862.16 3782 65968 11898.44 0 65968 86774 86774 0.00
 
DPS Timeline Chart
 

Action details: execution_sentence

Static Values
  • id:114157
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4096.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114157
  • name:Execution Sentence
  • school:holy
  • tooltip:
  • description:{$@spelldesc114916=A hammer slowly falls from the sky, causing ${$SPH*$114916m2/1000+26.72716306*$114916m1} Holy damage over {$114916d=10 seconds}. Damage increases over time, culminating in a final burst. Dispelling the effect triggers the final burst.} |CFFFFFFFFStay of Execution|R On a friendly target, the falling hammer heals for ${$SPH*$114917m2/1000+26.72716306*$114917m1} over {$114917d=10 seconds}. This healing is a large burst at first, and then decreases over time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.342049
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
exorcism 353 1.4% 9.3 18.14sec 11509 9108 Direct 9.3 9451 18897 10678 13.0% 2.4 2835 5666 13.0%  

Stats details: exorcism

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.26 9.26 0.00 0.00 1.2636 0.0000 106608.43 106608.43 0.00 9107.94 9107.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.31 13.03% 5666.08 5594 6897 1514.70 0 6897 1775 1775 0.00
multistrike 2.09 86.97% 2835.06 2797 3448 2469.47 0 3448 5927 5927 0.00
hit 8.06 87.02% 9451.10 9324 11494 9454.46 0 10409 76179 76179 0.00
crit 1.20 12.98% 18897.10 18648 22989 13399.98 0 22989 22728 22728 0.00
 
DPS Timeline Chart
 

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1280.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
Spelldata
  • id:879
  • name:Exorcism
  • school:holy
  • tooltip:
  • description:Blasts the target with Holy Light, causing {$s1=1} Holy damage and generating 1 Holy Power. Your autoattacks have a {$87138h=20}% chance of resetting the cooldown of your Exorcism.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.686240
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
final_verdict 5796 22.2% 66.8 4.47sec 26050 20469 Direct 66.8 21364 42963 24167 13.0% 17.4 6410 12904 13.0%  

Stats details: final_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.84 66.84 0.00 0.00 1.2726 0.0000 1741315.90 1741315.90 0.00 20469.45 20469.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.25 12.95% 12903.60 11893 16893 11505.11 0 16893 29014 29014 0.00
multistrike 15.11 87.05% 6410.00 5946 8446 6415.90 5946 7821 96882 96882 0.00
hit 58.17 87.02% 21363.75 19821 28155 21380.58 20450 22537 1242709 1242709 0.00
crit 8.68 12.98% 42963.24 39642 56310 42991.11 0 56310 372711 372711 0.00
 
DPS Timeline Chart
 

Action details: final_verdict

Static Values
  • id:157048
  • school:holy
  • resource:holy_power
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power=5|buff.holy_avenger.up&holy_power>=3
Spelldata
  • id:157048
  • name:Final Verdict
  • school:holy
  • tooltip:Damage and radius of your next Divine Storm increased by {$s3=100}%.
  • description:Empowers your weapon with holy energy, and performs a devastating strike, dealing $sw1 Holy damage. Also increases the damage and radius of your next Divine Storm by {$s3=100}%. Replaces Templar's Verdict.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
hammer_of_wrath 2011 7.6% 30.1 10.21sec 19981 15722 Direct 30.1 16323 33029 18543 13.3% 7.8 4893 9925 13.3%  

Stats details: hammer_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.08 30.07 0.00 0.00 1.2710 0.0000 601055.85 601055.85 0.00 15721.69 15721.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.04 13.27% 9924.50 8410 12441 6422.68 0 12441 10298 10298 0.00
multistrike 6.78 86.73% 4893.13 4205 6221 4893.41 0 6221 33190 33190 0.00
hit 26.07 86.72% 16323.21 14017 20736 16334.78 15047 17688 425627 425627 0.00
crit 3.99 13.28% 33029.30 28033 41471 32536.83 0 41471 131940 131940 0.00
 
DPS Timeline Chart
 

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a magical hammer that strikes an enemy for {$s1=1} Holy damage{$?s53503=false}[ and generates a charge of Holy Power][]. Only usable on enemies that have 20% or less health{$?s53503=false}[ or during Avenging Wrath][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.028000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
hand_of_light 6793 25.9% 226.0 1.68sec 9026 0 Direct 226.0 9026 0 9026 0.0% 0.0 0 0 0.0%  

Stats details: hand_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 225.95 225.95 0.00 0.00 0.0000 0.0000 2039333.86 2039333.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 225.95 100.00% 9025.55 1169 34018 9037.12 7865 10815 2039334 2039334 0.00
 
DPS Timeline Chart
 

Action details: hand_of_light

Static Values
  • id:96172
  • school:holy
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7135.64
  • base_dd_max:7135.64
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
judgment 1522 5.8% 39.4 7.58sec 11616 9183 Direct 39.4 9511 19189 10778 13.1% 10.2 2854 5749 13.0%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.38 39.38 0.00 0.00 1.2650 0.0000 457399.67 457399.67 0.00 9182.70 9182.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.33 13.00% 5749.03 5275 7804 4209.01 0 7804 7637 7637 0.00
multistrike 8.89 87.00% 2853.57 2638 3902 2855.11 0 3902 25372 25372 0.00
hit 34.22 86.91% 9510.83 8792 13006 9518.19 8792 10334 325497 325497 0.00
crit 5.15 13.09% 19189.32 17584 26013 19104.04 0 26013 98894 98894 0.00
 
DPS Timeline Chart
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.empowered_seals.enabled&time<2
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Causes {$s1=1} Holy damage {$?s105424=false}[and generates 1 Holy Power]?s85256[and generates 1 Holy Power][]. Requires an active Seal to cast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.696000
  • spell_power_mod.direct:0.576000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 2483 9.5% 98.6 3.04sec 7568 2488 Direct 98.6 6193 12462 7022 13.2% 25.5 1858 3744 13.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.58 98.58 0.00 0.00 3.0417 0.0000 746000.70 1146485.28 34.93 2488.00 2488.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.38 13.22% 3743.97 3456 4922 3605.62 0 4922 12643 19431 33.62
multistrike 22.17 86.78% 1857.64 1728 2461 1859.03 1728 2278 41177 63282 34.93
hit 85.54 86.78% 6192.65 5759 8204 6197.42 5969 6406 529729 814110 34.93
crit 13.04 13.22% 12462.42 11519 16407 12473.76 11519 16407 162451 249662 34.93
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
seal_of_truth_proc 1389 5.3% 297.0 1.01sec 1405 0 Direct 297.0 1148 2311 1303 13.4% 77.0 344 693 13.4%  

Stats details: seal_of_truth_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 297.02 297.02 0.00 0.00 0.0000 0.0000 417215.27 417215.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.34 13.43% 693.20 637 908 693.73 0 908 7168 7168 0.00
multistrike 66.66 86.57% 344.26 319 454 344.53 321 375 22949 22949 0.00
hit 257.28 86.62% 1147.65 1062 1513 1148.55 1115 1177 295272 295272 0.00
crit 39.74 13.38% 2310.73 2124 3026 2312.90 2124 2694 91826 91826 0.00
 
DPS Timeline Chart
 

Action details: seal_of_truth_proc

Static Values
  • id:31801
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31801
  • name:Seal of Truth
  • school:holy
  • tooltip:Melee attacks cause Holy damage over {$31803d=15 seconds}.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463sw1 additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R {$@spelldesc31803=Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.12
 
shattered_bleed 394 1.5% 17.5 17.55sec 6763 0 Direct 17.5 1651 3307 1875 13.5% 4.6 495 993 13.5%  
Periodic 97.7 787 0 787 0.0% 25.4 239 0 0.0% 32.5%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.49 17.49 97.72 97.72 0.0000 1.0000 118305.31 118305.31 0.00 1210.62 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.61 13.46% 992.50 956 1147 452.37 0 1147 609 609 0.00
multistrike 3.94 86.54% 495.33 478 573 485.09 0 573 1954 1954 0.00
hit 15.13 86.49% 1650.89 1593 1911 1650.78 1593 1792 24978 24978 0.00
crit 2.36 13.51% 3306.96 3186 3823 3000.75 0 3823 7814 7814 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 25.4 100.00% 238.93 239 239 238.93 239 239 6058 6058 0.00
hit 97.7 100.00% 786.84 1 796 787.15 758 796 76893 76893 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Zambo
avenging_wrath 3.0 121.50sec

Stats details: avenging_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 2.96 2.96 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.47 83.40% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.49 16.60% 0.00 0 0 0.00 0 0 0 0 0.00
 
HPS Timeline Chart
 

Action details: avenging_wrath

Static Values
  • id:31884
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:119.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:false
  • if_expr:talent.seraphim.enabled
Spelldata
  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
 
draenic_strength_potion 2.0 0.00sec

Stats details: draenic_strength_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156428
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156428
  • name:Draenic Strength Potion
  • school:physical
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your strength by {$s1=1000} for {$d=25 seconds}.
 
glyph_of_divine_storm 20.3 14.00sec

Stats details: glyph_of_divine_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 20.32 20.32 0.00 0.00 0.0000 0.0000 0.00 277273.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.86 16.29% 0.00 0 0 0.00 0 0 0 5610 56.59
multistrike 4.41 83.71% 0.00 0 0 0.00 0 0 0 14419 98.36
hit 17.02 83.76% 0.00 0 0 0.00 0 0 0 185370 100.00
crit 3.30 16.24% 0.00 0 0 0.00 0 0 0 71874 95.84
 
HPS Timeline Chart
 

Action details: glyph_of_divine_storm

Static Values
  • id:63220
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zambo
  • harmful:false
  • if_expr:
Spelldata
  • id:63220
  • name:Glyph of Divine Storm
  • school:physical
  • tooltip:
  • description:Your Divine Storm also heals you for {$115515s1=4}% of your maximum health.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
avenging_wrath 3.0 0.0 121.5sec 121.5sec 19.07% 41.43% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • avenging_wrath_1:19.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31884
  • name:Avenging Wrath
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_crusader 20.5 1.3 13.9sec 13.0sec 17.80% 100.00% 1.3(1.3)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_divine_crusader
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:0.00

Stack Uptimes

  • divine_crusader_1:17.80%

Trigger Attempt Success

  • trigger_pct:24.79%

Spelldata details

  • id:144595
  • name:Divine Crusader
  • tooltip:Your next Divine Storm is free and deals {$s2=50}% more damage.
  • description:{$@spelldesc144593=Holy Power consumers have a 25% chance to make your next Divine Storm free and deal {$144595s2=50}% more damage.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
divine_purpose 20.6 1.3 13.8sec 13.0sec 15.44% 100.00% 1.3(1.3)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:0.00

Stack Uptimes

  • divine_purpose_1:15.44%

Trigger Attempt Success

  • trigger_pct:24.80%

Spelldata details

  • id:86172
  • name:Divine Purpose
  • tooltip:
  • description:{$?s114163=false}[Eternal Flame][Word of Glory]{$?s53600=false}[ and Shield of the Righteous have]?s53563[ and Light of Dawn have]?s85256[, Templar's Verdict, and Divine Storm have][ has] a {$s1=25}% chance to cause your next {$?s114163=false}[Eternal Flame][Word of Glory] or {$?s53600=false}[Shield of the Righteous]?s53563[Light of Dawn]?s157048[Final Verdict or Divine Storm][Templar's Verdict or Divine Storm] to consume no Holy Power but cast as if 3 were consumed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:25.00%
draenic_strength_potion 2.0 0.0 122.8sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_draenic_strength_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:1000.00

Stack Uptimes

  • draenic_strength_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156428
  • name:Draenic Strength Potion
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your strength by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
final_verdict 21.1 63.1 14.0sec 3.5sec 76.95% 76.96% 63.1(63.1)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_final_verdict
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • final_verdict_1:76.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157048
  • name:Final Verdict
  • tooltip:Damage and radius of your next Divine Storm increased by {$s3=100}%.
  • description:Empowers your weapon with holy energy, and performs a devastating strike, dealing $sw1 Holy damage. Also increases the damage and radius of your next Divine Storm by {$s3=100}%. Replaces Templar's Verdict.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
glyph_double_jeopardy (glyph_double_jeopardy) 7.8 41.8 41.1sec 6.0sec 87.42% 87.42% 41.8(41.8)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_glyph_double_jeopardy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • glyph_double_jeopardy_1:87.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:54922
  • name:Glyph of Double Jeopardy
  • tooltip:
  • description:Judging a target increases the damage of your next Judgment by {$121027s1=20}%, but only if used on a different second target.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
selfless_healer 3.4 46.2 97.6sec 6.0sec 94.54% 94.54% 40.3(40.3)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_selfless_healer
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • selfless_healer_1:6.01%
  • selfless_healer_2:5.86%
  • selfless_healer_3:82.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114250
  • name:Selfless Healer
  • tooltip:Your next Flash of Light casts $w1% faster, costs $w3% less mana, and heals for $w2% greater effectiveness on others.
  • description:{$@spelldesc85804=Your successful Judgments reduce the cast time and mana cost of your next Flash of Light by {$114250s1=35}%, and increase its effect on others by $?c1[{$114250s4=35}][{$114250s2=20}]%. Stacks up to 3 times.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
tectus_heartbeat 5.7 0.0 50.9sec 50.4sec 18.66% 18.67% 0.0(0.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_tectus_heartbeat
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:2004.00

Stack Uptimes

  • tectus_heartbeat_1:18.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177040
  • name:Tectus' Heartbeat
  • tooltip:Increases Critical Strike by {$s1=1135}.
  • description:Increases Critical Strike by {$s1=1135} for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_strength_flask

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
seal_of_truth

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_seal_of_truth
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • seal_of_truth_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31801
  • name:Seal of Truth
  • tooltip:Melee attacks cause Holy damage over {$31803d=15 seconds}.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463sw1 additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R {$@spelldesc31803=Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Zambo
crusader_strike Mana 62.1 39771.4 640.0 640.0 13.1
execution_sentence Mana 5.5 22347.0 4096.0 4095.9 16.9
exorcism Mana 9.3 11856.9 1280.0 1280.0 9.0
final_verdict Holy Power 66.8 139.3 2.1 2.1 12500.3
hammer_of_wrath Mana 30.1 28877.5 960.0 960.0 20.8
Resource Gains Type Count Total Average Overflow
glyph_of_divine_storm Health 25.59 0.00 (0.00%) 0.00 277268.83 100.00%
external_healing Health 8.18 0.00 (0.00%) 0.00 76414.77 100.00%
leech Health 1348.85 0.00 (0.00%) 0.00 34300.23 100.00%
sword_of_light Mana 149.64 102068.89 (100.00%) 682.10 185238.95 64.47%
crusader_strike Holy Power 62.14 62.14 (44.12%) 1.00 0.00 0.00%
exorcism Holy Power 9.26 9.26 (6.58%) 1.00 0.00 0.00%
hammer_of_wrath Holy Power 30.07 30.07 (21.35%) 1.00 0.00 0.00%
judgment Holy Power 39.38 39.38 (27.96%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 339.21 341.82
Holy Power 0.47 0.46
Combat End Resource Mean Min Max
Mana 31219.18 26944.00 32000.00
Holy Power 1.55 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 41.0%

Procs

Count Interval
divine_purpose 21.8 13.0sec
divine_crusader 21.8 13.0sec
exorcism_cd_reset 19.7 14.7sec
wasted_exorcism_cd_reset 14.1 20.7sec

Statistics & Data Analysis

Fight Length
Sample Data Zambo Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Zambo Damage Per Second
Count 25000
Mean 26177.51
Minimum 22986.64
Maximum 30745.44
Spread ( max - min ) 7758.80
Range [ ( max - min ) / 2 * 100% ] 14.82%
Standard Deviation 933.1295
5th Percentile 24711.43
95th Percentile 27785.87
( 95th Percentile - 5th Percentile ) 3074.44
Mean Distribution
Standard Deviation 5.9016
95.00% Confidence Intervall ( 26165.94 - 26189.08 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4881
0.1 Scale Factor Error with Delta=300 7433
0.05 Scale Factor Error with Delta=300 29732
0.01 Scale Factor Error with Delta=300 743305
Distribution Chart
DPS(e)
Sample Data Zambo Damage Per Second (Effective)
Count 25000
Mean 26177.51
Minimum 22986.64
Maximum 30745.44
Spread ( max - min ) 7758.80
Range [ ( max - min ) / 2 * 100% ] 14.82%
Damage
Sample Data Zambo Damage
Count 25000
Mean 7860487.72
Minimum 5779959.76
Maximum 10181454.96
Spread ( max - min ) 4401495.19
Range [ ( max - min ) / 2 * 100% ] 28.00%
DTPS
Sample Data Zambo Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zambo Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Zambo Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zambo Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zambo Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zambo Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ZamboTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Zambo Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=sleeper_surprise
2 0.00 blessing_of_kings,if=!aura.str_agi_int.up
3 0.00 blessing_of_might,if=!aura.mastery.up
4 0.00 seal_of_truth,if=active_enemies<2
5 0.00 seal_of_righteousness,if=active_enemies>=2
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=draenic_strength
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 rebuke
9 1.00 potion,name=draenic_strength,if=(buff.bloodlust.react|buff.avenging_wrath.up|target.time_to_die<=40)
A 1.00 auto_attack
B 0.00 speed_of_light,if=movement.distance>5
C 0.00 judgment,if=talent.empowered_seals.enabled&time<2
D 5.46 execution_sentence
E 0.00 lights_hammer
F 0.00 holy_avenger,sync=seraphim,if=talent.seraphim.enabled
G 0.00 holy_avenger,if=holy_power<=2&!talent.seraphim.enabled
H 0.00 avenging_wrath,sync=seraphim,if=talent.seraphim.enabled
I 2.96 avenging_wrath,if=!talent.seraphim.enabled
J 0.00 blood_fury
K 0.00 berserking
L 0.00 arcane_torrent
M 0.00 seraphim
N 0.00 wait,sec=cooldown.seraphim.remains,if=talent.seraphim.enabled&cooldown.seraphim.remains>0&cooldown.seraphim.remains<gcd.max&holy_power>=5
O 0.00 call_action_list,name=aoe,if=active_enemies>=5
P 0.00 call_action_list,name=cleave,if=active_enemies>=3
Q 0.00 call_action_list,name=single
actions.single
# count action,conditions
R 0.09 divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
S 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&active_enemies=2&!talent.final_verdict.enabled
T 0.00 divine_storm,if=holy_power=5&active_enemies=2&buff.final_verdict.up
U 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&(talent.seraphim.enabled&cooldown.seraphim.remains<=4)
V 0.00 templars_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
W 0.00 templars_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<3
X 0.00 divine_storm,if=buff.divine_crusader.react&buff.divine_crusader.remains<3&!talent.final_verdict.enabled
Y 2.30 final_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3
Z 0.25 final_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<4
a 30.08 hammer_of_wrath
b 0.00 judgment,if=talent.empowered_seals.enabled&seal.truth&buff.maraads_truth.remains<cooldown.judgment.duration
c 0.00 judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<cooldown.judgment.duration
d 0.00 exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
e 0.00 seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.down
f 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.down&!buff.avenging_wrath.up&!buff.bloodlust.up
g 10.43 divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up&(buff.avenging_wrath.up|target.health.pct<35)
h 34.17 final_verdict,if=buff.avenging_wrath.up|target.health.pct<35
i 0.00 templars_verdict,if=buff.avenging_wrath.up|target.health.pct<35&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
j 62.14 crusader_strike,if=holy_power<5
k 0.00 divine_storm,if=buff.divine_crusader.react&(buff.avenging_wrath.up|target.health.pct<35)&!talent.final_verdict.enabled
l 9.79 divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up
m 9.66 final_verdict,if=buff.divine_purpose.react
n 10.62 final_verdict,if=holy_power>=4
o 1.00 judgment,cycle_targets=1,if=last_judgment_target!=target&glyph.double_jeopardy.enabled&holy_power<5&cooldown.seraphim.remains<=3
p 0.00 exorcism,if=glyph.mass_exorcism.enabled&active_enemies>=2&holy_power<5
q 38.38 judgment,,if=holy_power<5
r 9.86 final_verdict,if=holy_power>=3
s 0.00 exorcism,if=talent.seraphim.enabled&cooldown.seraphim.remains<=15
t 0.00 templars_verdict,if=buff.divine_purpose.react
u 0.00 divine_storm,if=buff.divine_crusader.react&!talent.final_verdict.enabled
v 0.00 templars_verdict,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)
w 0.00 seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.remains<cooldown.judgment.duration
x 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.remains<cooldown.judgment.duration&!buff.bloodlust.up
y 9.26 exorcism,if=holy_power<5
z 0.00 templars_verdict,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>9)
{ 0.00 holy_prism

Sample Sequence

0147ADIajohaghjahjqahhjaqhhjmqjrljmmjqrjyqjnqjryjqrjlmjlqjnlDjqrjlqjrljmmjlqjnljmljmmjnmjqrjlmjqrjlmjlmjlqDI9aYgjahjqahhjahjqyjnljqrjmqjryjqrjqjryjqrjqjDrjmajhgajqhahhgajhgahghajhqajhqajhqajhqajhqajDIhahjqahgjahjqahjqahjqahjqahjqahjqahg

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre food Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre seal_of_truth Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power draenic_strength_potion
0:00.000 auto_attack Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_strength_potion
0:00.000 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_strength_potion
0:01.322 avenging_wrath Zambo 27904.0/32000: 87% mana | 0.0/5: 0% holy_power bloodlust, tectus_heartbeat, draenic_strength_potion
0:01.322 hammer_of_wrath Fluffy_Pillow 27904.0/32000: 87% mana | 0.0/5: 0% holy_power bloodlust, avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:02.337 crusader_strike Fluffy_Pillow 28864.0/32000: 90% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:03.355 judgment Fluffy_Pillow 28224.0/32000: 88% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:04.371 final_verdict Fluffy_Pillow 30144.0/32000: 94% mana | 3.0/5: 60% holy_power bloodlust, glyph_double_jeopardy, selfless_healer(2), avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:05.388 hammer_of_wrath Fluffy_Pillow 30144.0/32000: 94% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2), avenging_wrath, divine_crusader, tectus_heartbeat, draenic_strength_potion
0:06.406 divine_storm Fluffy_Pillow 31104.0/32000: 97% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2), avenging_wrath, divine_crusader, tectus_heartbeat, draenic_strength_potion
0:07.422 final_verdict Fluffy_Pillow 31104.0/32000: 97% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, divine_purpose, selfless_healer(2), avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:08.439 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2), avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:09.457 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2), avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:10.474 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2), avenging_wrath, draenic_strength_potion
0:11.490 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2), avenging_wrath, draenic_strength_potion
0:12.508 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2), avenging_wrath, draenic_strength_potion
0:13.527 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
0:14.546 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
0:15.564 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
0:16.581 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
0:17.600 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
0:18.618 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
0:19.634 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat, draenic_strength_potion
0:20.652 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3), avenging_wrath, tectus_heartbeat
0:21.670 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3), tectus_heartbeat
0:22.686 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3), tectus_heartbeat
0:23.703 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3), tectus_heartbeat
0:24.722 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3), tectus_heartbeat
0:25.739 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3), tectus_heartbeat
0:26.756 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3), divine_crusader, tectus_heartbeat
0:27.775 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, divine_purpose, selfless_healer(3), tectus_heartbeat
0:28.794 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, divine_purpose, selfless_healer(3)
0:29.814 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3)
0:30.833 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:31.850 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:32.867 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:33.886 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:34.903 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:35.920 judgment Fluffy_Pillow 30720.0/32000: 96% mana | 2.0/5: 40% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:36.938 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:37.956 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:38.972 Waiting 1.000 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:39.972 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:40.990 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:42.006 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:43.328 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:44.647 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:45.969 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:47.289 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:48.610 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
0:49.932 divine_storm Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
0:51.253 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, divine_purpose, selfless_healer(3), divine_crusader
0:52.575 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
0:53.896 divine_storm Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
0:55.218 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
0:56.539 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
0:57.862 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, selfless_healer(3), tectus_heartbeat
0:59.184 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader, tectus_heartbeat
1:00.505 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader, tectus_heartbeat
1:01.827 crusader_strike Fluffy_Pillow 27904.0/32000: 87% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader, tectus_heartbeat
1:03.148 judgment Fluffy_Pillow 29184.0/32000: 91% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader, tectus_heartbeat
1:04.470 final_verdict Fluffy_Pillow 31104.0/32000: 97% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader, tectus_heartbeat
1:05.791 crusader_strike Fluffy_Pillow 31104.0/32000: 97% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader, tectus_heartbeat
1:07.114 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader, tectus_heartbeat
1:08.434 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
1:09.756 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
1:11.080 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
1:12.401 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3), divine_crusader
1:13.722 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, divine_purpose, selfless_healer(3)
1:15.043 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, divine_purpose, selfless_healer(3)
1:16.366 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3)
1:17.686 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:19.008 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), divine_crusader
1:20.330 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3), divine_crusader
1:21.652 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
1:22.972 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
1:24.292 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:25.614 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, divine_purpose, selfless_healer(3), divine_crusader
1:26.936 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, divine_purpose, selfless_healer(3), divine_crusader
1:28.258 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:29.581 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, divine_purpose, selfless_healer(3)
1:30.903 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power divine_purpose, selfless_healer(3)
1:32.224 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power divine_purpose, final_verdict, selfless_healer(3)
1:33.544 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3)
1:34.866 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict, selfless_healer(3)
1:36.188 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, final_verdict
1:37.509 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict
1:38.831 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict
1:40.151 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
1:41.472 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(2), divine_crusader, tectus_heartbeat
1:42.794 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(2), divine_crusader, tectus_heartbeat
1:44.116 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, divine_purpose, selfless_healer(2), tectus_heartbeat
1:45.437 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2), tectus_heartbeat
1:46.760 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2), tectus_heartbeat
1:48.081 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), tectus_heartbeat
1:49.403 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader, tectus_heartbeat
1:50.725 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:52.046 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, divine_purpose, selfless_healer(3), divine_crusader
1:53.367 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:54.688 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
1:56.008 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, divine_purpose, selfless_healer(3), divine_crusader
1:57.330 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), divine_crusader
1:58.650 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), divine_crusader
1:59.971 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3)
2:01.291 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, selfless_healer(3)
2:02.612 avenging_wrath Zambo 29824.0/32000: 93% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, selfless_healer(3)
2:02.612 potion Fluffy_Pillow 29824.0/32000: 93% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath
2:02.612 hammer_of_wrath Fluffy_Pillow 29824.0/32000: 93% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:03.932 final_verdict Fluffy_Pillow 28864.0/32000: 90% mana | 5.0/5: 100% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:05.255 divine_storm Fluffy_Pillow 30784.0/32000: 96% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, draenic_strength_potion
2:06.576 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:07.898 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:09.221 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:10.542 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:11.864 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:13.183 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:14.506 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:15.828 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:17.150 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:18.472 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:19.793 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:21.115 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:22.440 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, draenic_strength_potion
2:23.761 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), draenic_strength_potion
2:25.082 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), draenic_strength_potion
2:26.403 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), draenic_strength_potion
2:27.725 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
2:29.046 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3)
2:30.368 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
2:31.690 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
2:33.013 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3)
2:34.335 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3)
2:35.657 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:36.979 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:38.302 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:39.625 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:40.947 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:42.269 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:43.591 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:44.913 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:46.235 Waiting 1.400 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:47.635 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:48.957 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:50.279 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:51.600 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:52.923 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:54.244 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:55.565 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), tectus_heartbeat
2:56.887 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), tectus_heartbeat
2:58.209 Waiting 1.400 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), tectus_heartbeat
2:59.609 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), tectus_heartbeat
3:00.931 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), tectus_heartbeat
3:02.253 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), tectus_heartbeat
3:03.573 final_verdict Fluffy_Pillow 27904.0/32000: 87% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), tectus_heartbeat
3:04.895 crusader_strike Fluffy_Pillow 29824.0/32000: 93% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3)
3:06.216 final_verdict Fluffy_Pillow 31104.0/32000: 97% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3), tectus_heartbeat
3:07.539 hammer_of_wrath Fluffy_Pillow 31104.0/32000: 97% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), tectus_heartbeat
3:08.861 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), tectus_heartbeat
3:10.183 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), tectus_heartbeat
3:11.505 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), divine_crusader, tectus_heartbeat
3:12.828 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power selfless_healer(3), tectus_heartbeat
3:14.150 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power selfless_healer(3), tectus_heartbeat
3:15.470 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power
3:16.792 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer
3:18.113 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer
3:19.435 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer
3:20.758 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer
3:22.079 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer, divine_crusader
3:23.400 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer, divine_crusader
3:24.720 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer, divine_crusader
3:26.042 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer, divine_crusader
3:27.363 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer, divine_crusader
3:28.683 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power divine_purpose, selfless_healer
3:30.005 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose, selfless_healer
3:31.328 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, divine_crusader
3:32.650 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power divine_purpose
3:33.970 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict
3:35.293 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict
3:36.616 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict
3:37.938 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict
3:39.258 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
3:40.579 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
3:41.899 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
3:43.222 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
3:44.543 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
3:45.864 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
3:47.185 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
3:48.507 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
3:49.829 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:51.149 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:52.471 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:53.793 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:55.115 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:56.437 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:57.760 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:59.080 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:00.400 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:01.721 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:03.042 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:04.364 avenging_wrath Zambo 29824.0/32000: 93% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:04.364 final_verdict Fluffy_Pillow 29824.0/32000: 93% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath
4:05.685 hammer_of_wrath Fluffy_Pillow 29824.0/32000: 93% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3), avenging_wrath
4:07.006 final_verdict Fluffy_Pillow 30784.0/32000: 96% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, divine_purpose, final_verdict, selfless_healer(3), avenging_wrath
4:08.327 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath
4:09.647 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:10.968 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath
4:12.289 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath
4:13.611 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, divine_crusader
4:14.931 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath
4:16.251 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath
4:17.573 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath
4:18.894 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath
4:20.216 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:21.537 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath
4:22.858 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath
4:24.180 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath
4:25.500 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:26.821 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:28.142 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:29.463 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:30.782 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:32.103 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:33.425 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:34.746 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:36.068 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:37.391 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:38.713 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:40.036 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:41.358 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:42.679 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:43.999 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:45.320 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:46.640 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:47.962 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:49.283 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
4:50.606 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4733 4245 4116 (1424)
Agility 477 455 455
Stamina 4539 4127 4127
Intellect 1094 1042 1042
Spirit 782 782 782
Health 272340 247620 0
Mana 32000 32000 0
Holy Power 5 5 0
Spell Power 5206 4245 0
Crit 12.75% 7.75% 302
Haste 13.89% 8.47% 847
Multistrike 12.97% 7.97% 526
Damage / Heal Versatility 6.19% 3.19% 415
Attack Power 5206 4245 0
Mastery 60.41% 46.44% 1390
Armor 2013 2013 2013

Talents

Level
15 Speed of Light Long Arm of the Law Pursuit of Justice
30 Fist of Justice Repentance Blinding Light
45 Selfless Healer Eternal Flame Sacred Shield
60 Hand of Purity Unbreakable Spirit Clemency
75 Holy Avenger Sanctified Wrath Divine Purpose
90 Holy Prism Light's Hammer Execution Sentence
100 Empowered Seals Seraphim Final Verdict (Retribution Paladin)

Profile

paladin="Zambo"
origin="http://eu.battle.net/wow/en/character/dalvengyr/Zambo/advanced"
thumbnail="http://eu.battle.net/static-render/eu/nazjatar/126/78079358-avatar.jpg"
level=100
race=human
role=attack
position=back
professions=blacksmithing=700/mining=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#bb!2001222
glyphs=divine_storm/templars_verdict/double_jeopardy/bladed_judgment/fire_from_the_heavens/winged_vengeance
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_strength_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/blessing_of_kings,if=!aura.str_agi_int.up
actions.precombat+=/blessing_of_might,if=!aura.mastery.up
actions.precombat+=/seal_of_truth,if=active_enemies<2
actions.precombat+=/seal_of_righteousness,if=active_enemies>=2
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_strength

# Executed every time the actor is available.

actions=rebuke
actions+=/potion,name=draenic_strength,if=(buff.bloodlust.react|buff.avenging_wrath.up|target.time_to_die<=40)
actions+=/auto_attack
actions+=/speed_of_light,if=movement.distance>5
actions+=/judgment,if=talent.empowered_seals.enabled&time<2
actions+=/execution_sentence
actions+=/lights_hammer
actions+=/holy_avenger,sync=seraphim,if=talent.seraphim.enabled
actions+=/holy_avenger,if=holy_power<=2&!talent.seraphim.enabled
actions+=/avenging_wrath,sync=seraphim,if=talent.seraphim.enabled
actions+=/avenging_wrath,if=!talent.seraphim.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/seraphim
actions+=/wait,sec=cooldown.seraphim.remains,if=talent.seraphim.enabled&cooldown.seraphim.remains>0&cooldown.seraphim.remains<gcd.max&holy_power>=5
actions+=/call_action_list,name=aoe,if=active_enemies>=5
actions+=/call_action_list,name=cleave,if=active_enemies>=3
actions+=/call_action_list,name=single

actions.single=divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&active_enemies=2&!talent.final_verdict.enabled
actions.single+=/divine_storm,if=holy_power=5&active_enemies=2&buff.final_verdict.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&(talent.seraphim.enabled&cooldown.seraphim.remains<=4)
actions.single+=/templars_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
actions.single+=/templars_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<3
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.divine_crusader.remains<3&!talent.final_verdict.enabled
actions.single+=/final_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3
actions.single+=/final_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<4
actions.single+=/hammer_of_wrath
actions.single+=/judgment,if=talent.empowered_seals.enabled&seal.truth&buff.maraads_truth.remains<cooldown.judgment.duration
actions.single+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<cooldown.judgment.duration
actions.single+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.single+=/seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.down
actions.single+=/seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.down&!buff.avenging_wrath.up&!buff.bloodlust.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up&(buff.avenging_wrath.up|target.health.pct<35)
actions.single+=/final_verdict,if=buff.avenging_wrath.up|target.health.pct<35
actions.single+=/templars_verdict,if=buff.avenging_wrath.up|target.health.pct<35&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
actions.single+=/crusader_strike,if=holy_power<5
actions.single+=/divine_storm,if=buff.divine_crusader.react&(buff.avenging_wrath.up|target.health.pct<35)&!talent.final_verdict.enabled
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up
actions.single+=/final_verdict,if=buff.divine_purpose.react
actions.single+=/final_verdict,if=holy_power>=4
actions.single+=/judgment,cycle_targets=1,if=last_judgment_target!=target&glyph.double_jeopardy.enabled&holy_power<5&cooldown.seraphim.remains<=3
actions.single+=/exorcism,if=glyph.mass_exorcism.enabled&active_enemies>=2&holy_power<5
actions.single+=/judgment,,if=holy_power<5
actions.single+=/final_verdict,if=holy_power>=3
actions.single+=/exorcism,if=talent.seraphim.enabled&cooldown.seraphim.remains<=15
actions.single+=/templars_verdict,if=buff.divine_purpose.react
actions.single+=/divine_storm,if=buff.divine_crusader.react&!talent.final_verdict.enabled
actions.single+=/templars_verdict,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)
actions.single+=/seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.remains<cooldown.judgment.duration
actions.single+=/seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.remains<cooldown.judgment.duration&!buff.bloodlust.up
actions.single+=/exorcism,if=holy_power<5
actions.single+=/templars_verdict,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>9)
actions.single+=/holy_prism

actions.cleave=final_verdict,if=buff.final_verdict.down&holy_power=5
actions.cleave+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
actions.cleave+=/divine_storm,if=holy_power=5&buff.final_verdict.up
actions.cleave+=/divine_storm,if=holy_power=5&(!talent.seraphim.enabled|cooldown.seraphim.remains>4)&!talent.final_verdict.enabled
actions.cleave+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.cleave+=/hammer_of_wrath
actions.cleave+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<=5
actions.cleave+=/divine_storm,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)&!talent.final_verdict.enabled
actions.cleave+=/crusader_strike
actions.cleave+=/divine_storm,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)&!talent.final_verdict.enabled
actions.cleave+=/final_verdict,if=buff.final_verdict.down
actions.cleave+=/divine_storm,if=buff.final_verdict.up
actions.cleave+=/exorcism,if=glyph.mass_exorcism.enabled
actions.cleave+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled
actions.cleave+=/judgment
actions.cleave+=/exorcism

actions.aoe=divine_storm,if=holy_power=5&(!talent.seraphim.enabled|cooldown.seraphim.remains>4)
actions.aoe+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.aoe+=/hammer_of_wrath
actions.aoe+=/hammer_of_the_righteous
actions.aoe+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<=5
actions.aoe+=/divine_storm,if=(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
actions.aoe+=/exorcism,if=glyph.mass_exorcism.enabled
actions.aoe+=/holy_prism,target=self
actions.aoe+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled
actions.aoe+=/judgment
actions.aoe+=/exorcism

head=casque_of_the_iron_bomber,id=113600,bonus_id=566
neck=koraghs_family_locket,id=113841,bonus_id=560,enchant=75mastery
shoulders=primal_gladiators_plate_shoulders,id=115740
back=cloak_of_ruminant_deception,id=113830,bonus_id=566,enchant=gift_of_mastery
chest=truesteel_breastplate,id=114232,bonus_id=181/526/534
wrists=crazed_bombers_bracers,id=114496,bonus_id=488
hands=gauntlets_of_the_heavy_hand,id=113632
waist=bouldercrush_girdle,id=118948,bonus_id=141/560
legs=legplates_of_fractured_crystal,id=113648,bonus_id=41
feet=entrail_squishers,id=113633,bonus_id=564/566,gems=50mastery
finger1=timeless_solium_band_of_brutality,id=118295,enchant=30mastery
finger2=grunts_solid_signet,id=113599,enchant=50mastery
trinket1=grandiose_carnage,id=114552
trinket2=tectus_beating_heart,id=113645,bonus_id=40/566
main_hand=grandiose_greataxe,id=115328,bonus_id=115/560,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_strength=2589
# gear_stamina=3237
# gear_crit_rating=302
# gear_haste_rating=847
# gear_mastery_rating=1324
# gear_armor=2013
# gear_multistrike_rating=526
# gear_versatility_rating=315
# gear_leech_rating=120
# gear_avoidance_rating=104

Ðepeche

Ðepeche : 24835 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
24834.9 24834.9 9.8 / 0.039% 3019.3 / 12.2% 59.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
419.4 419.4 Mana 2.28% 47.9 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Ðepeche/advanced
Talents
  • 15: Pursuit of Justice
  • 30: Fist of Justice
  • 45: Selfless Healer
  • 60: Unbreakable Spirit
  • 75: Sanctified Wrath
  • 90: Execution Sentence
  • 100: Final Verdict (Retribution Paladin)
  • Talent Calculator
Glyphs
  • Glyph of Hand of Sacrifice
  • Glyph of Double Jeopardy
  • Glyph of Templar's Verdict
  • Glyph of Seal of Blood
  • Glyph of Winged Vengeance
  • Glyph of Righteous Retreat
Professions
  • blacksmithing: 700
  • jewelcrafting: 700

Charts

http://4.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=%C3%90epeche+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:51861|20222|19516|17167|8354|7814|6389|2449&chds=0,103722&chco=FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,C79C6E&chm=t++51861++execution_sentence,FFE57F,0,0,15|t++20222++final_verdict,FFE57F,1,0,15|t++19516++divine_storm,FFE57F,2,0,15|t++17167++hammer_of_wrath,FFE57F,3,0,15|t++8354++exorcism,FFE57F,4,0,15|t++7814++judgment,FFE57F,5,0,15|t++6389++crusader_strike,C79C6E,6,0,15|t++2449++melee,C79C6E,7,0,15& http://5.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=%C3%90epeche+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:24,18,15,10,7,6,5,5,5,3,2,1&chds=0,100&chdls=ffffff&chco=FFE57F,FFE57F,FFE57F,C79C6E,C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,C79C6E,FFE57F&chl=hand_of_light|final_verdict|hammer_of_wrath|melee|crusader_strike|seal_of_truth_proc|divine_storm|execution_sentence|judgment|censure|shattered_bleed|exorcism&
http://7.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=%C3%90epeche+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:filoruwz257787645320ywutrqpnmkjihfedbaZYYXWWWWVVUUTSTTUTUUUUUWXWWWXWWWXYXWWXWWWWVTTUUTTUUTUTUUTTUTTUUUUUTUTTTUTTUVWXZaddfikkmnpqrsuwvvwwuuttrpnomkkjigfeecbaaYXXWWVVVWVUVVUVUUVUUWWVWXYXYXYYYYZZZZZZZYYZXXXXWXXXXXWXXXXXXXXXXYXXYYXYYYYXXYYYZbbbdefghhjijkllmmmnmlmmkjjihhgggeeedccbcbaZaZYYYYXYYYYXXXXXXXYYYYaZZaaZaaaaaaabaaaaZZYYYXXYYXYYXYYXYYXXYXXXXYYXXYXXXXWXYYZZYZYWVUTRQPON&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.4875,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=24835|max=50943&chxp=1,1,49,100 http://0.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=%C3%90epeche+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,2,7,7,23,38,50,88,150,213,305,400,510,603,719,815,961,1065,1111,1229,1267,1313,1339,1303,1388,1288,1230,1168,1094,994,796,752,627,507,447,351,240,188,140,89,52,48,38,14,9,9,4,5,2,1&chds=0,1388&chbh=5&chxt=x&chxl=0:|min=22208|avg=24835|max=27853&chxp=0,1,47,100& http://6.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=%C3%90epeche+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:26.4,22.1,21.5,14.8,6.7,4.1,2.4,2.3&chds=0,100&chdls=ffffff&chco=C79C6E,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,FFE57F,ffffff&chl=crusader_strike 79.6s|final_verdict 66.5s|hammer_of_wrath 64.6s|judgment 44.5s|divine_storm 20.2s|exorcism 12.3s|execution_sentence 7.2s|waiting 6.9s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Ðepeche 24835
censure 721 2.9% 303.6 0.99sec 714 0 Periodic 99.4 1761 3673 2046 14.9% 22.1 528 1101 14.9% 99.1%

Stats details: censure

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 303.59 303.59 99.37 99.37 0.0000 3.0000 216911.95 216911.95 0.00 727.60 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 303.59 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.3 14.86% 1100.53 972 1449 1058.90 0 1449 3616 3616 0.00
multistrike 18.8 85.14% 528.25 486 725 528.66 486 617 9946 9946 0.00
hit 84.5 85.07% 1760.83 1620 2415 1762.14 1695 1822 148850 148850 0.00
crit 14.8 14.93% 3672.88 3240 4830 3678.65 3240 4830 54500 54500 0.00
 
DPS Timeline Chart
 

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31803
  • name:Censure
  • school:holy
  • tooltip:Holy damage every $t1 sec.
  • description:Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.061776
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
crusader_strike 1690 6.8% 63.3 4.74sec 8028 6389 Direct 63.3 6526 13503 7526 14.3% 14.1 1958 4050 14.5%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.31 63.31 0.00 0.00 1.2565 0.0000 508277.65 781142.49 34.93 6389.17 6389.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.03 14.45% 4050.21 3658 5233 3498.86 0 5233 8231 12650 30.15
multistrike 12.03 85.55% 1958.36 1829 2616 1959.44 1829 2616 23557 36203 34.93
hit 54.24 85.66% 6525.72 6097 8721 6529.86 6227 6837 353935 543942 34.93
crit 9.08 14.34% 13502.82 12195 17442 13521.25 0 17442 122555 188347 34.93
 
DPS Timeline Chart
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:640.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<5
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:{$?s85673=true}|s85256[An instant strike that causes $sw2 Physical damage and grants 1 Holy Power.][An instant strike that causes $sw2 Physical damage.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
divine_storm 1313 5.3% 16.1 17.57sec 24535 19516 Direct 16.1 19820 41216 23002 14.9% 3.6 5947 12376 15.0%  

Stats details: divine_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.07 16.07 0.00 0.00 1.2572 0.0000 394333.93 394333.93 0.00 19515.69 19515.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.53 14.95% 12376.23 10964 15681 5063.40 0 15681 6600 6600 0.00
multistrike 3.03 85.05% 5946.93 5482 7841 5621.39 0 7841 18035 18035 0.00
hit 13.68 85.13% 19820.38 18273 26136 19838.69 18273 26136 271183 271183 0.00
crit 2.39 14.87% 41215.69 36546 52271 37399.64 0 52271 98516 98516 0.00
 
DPS Timeline Chart
 

Action details: divine_storm

Static Values
  • id:53385
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
Spelldata
  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Deals $sw1 Holy damage to all enemies within $A1 yards. {$?s63220=false}[Using Divine Storm will also heal you for {$115515s1=4}% of your maximum health.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.78
 
execution_sentence 1238 5.0% 5.5 60.46sec 67652 51861 Periodic 53.7 5369 11934 6479 16.9% 11.9 1616 3566 16.8% 17.8%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.48 5.48 53.66 53.66 1.3045 1.0000 370804.64 370804.64 0.00 6097.76 51860.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.0 16.76% 3565.99 1076 18918 3076.43 0 18918 7126 7126 0.00
multistrike 9.9 83.24% 1616.28 538 9459 1617.75 0 7902 16036 16036 0.00
hit 44.6 83.09% 5368.76 1794 31530 5375.65 3188 6952 239388 239388 0.00
crit 9.1 16.91% 11933.83 3587 63061 11985.99 0 56908 108255 108255 0.00
 
DPS Timeline Chart
 

Action details: execution_sentence

Static Values
  • id:114157
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4096.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114157
  • name:Execution Sentence
  • school:holy
  • tooltip:
  • description:{$@spelldesc114916=A hammer slowly falls from the sky, causing ${$SPH*$114916m2/1000+26.72716306*$114916m1} Holy damage over {$114916d=10 seconds}. Damage increases over time, culminating in a final burst. Dispelling the effect triggers the final burst.} |CFFFFFFFFStay of Execution|R On a friendly target, the falling hammer heals for ${$SPH*$114917m2/1000+26.72716306*$114917m1} over {$114917d=10 seconds}. This healing is a large burst at first, and then decreases over time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.342049
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
exorcism 339 1.4% 9.7 16.31sec 10625 8354 Direct 9.7 8844 17688 9959 12.6% 2.2 2653 5306 12.4%  

Stats details: exorcism

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.67 9.67 0.00 0.00 1.2718 0.0000 102709.30 102709.30 0.00 8354.42 8354.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.27 12.43% 5306.31 5306 5306 1249.10 0 5306 1425 1425 0.00
multistrike 1.89 87.57% 2653.15 2653 2653 2250.40 0 2653 5017 5017 0.00
hit 8.45 87.39% 8843.84 8844 8844 8843.84 8844 8844 74709 74709 0.00
crit 1.22 12.61% 17687.69 17688 17688 12610.62 0 17688 21558 21558 0.00
 
DPS Timeline Chart
 

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1280.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
Spelldata
  • id:879
  • name:Exorcism
  • school:holy
  • tooltip:
  • description:Blasts the target with Holy Light, causing {$s1=1} Holy damage and generating 1 Holy Power. Your autoattacks have a {$87138h=20}% chance of resetting the cooldown of your Exorcism.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.686240
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
final_verdict 4474 18.0% 52.9 5.65sec 25381 20222 Direct 52.9 20473 42634 23795 15.0% 11.8 6143 12787 15.0%  

Stats details: final_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.95 52.95 0.00 0.00 1.2551 0.0000 1343791.02 1343791.02 0.00 20221.98 20221.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.76 15.00% 12787.12 11245 16083 10547.17 0 16083 22569 22569 0.00
multistrike 10.00 85.00% 6142.64 5622 8042 6147.70 0 8042 61414 61414 0.00
hit 45.01 85.01% 20472.70 18742 26806 20486.63 19516 21441 921480 921480 0.00
crit 7.94 14.99% 42634.35 37483 53611 42696.38 0 53611 338327 338327 0.00
 
DPS Timeline Chart
 

Action details: final_verdict

Static Values
  • id:157048
  • school:holy
  • resource:holy_power
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power=5|buff.holy_avenger.up&holy_power>=3
Spelldata
  • id:157048
  • name:Final Verdict
  • school:holy
  • tooltip:Damage and radius of your next Divine Storm increased by {$s3=100}%.
  • description:Empowers your weapon with holy energy, and performs a devastating strike, dealing $sw1 Holy damage. Also increases the damage and radius of your next Divine Storm by {$s3=100}%. Replaces Templar's Verdict.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
hammer_of_wrath 3712 14.9% 53.0 5.72sec 20936 17167 Direct 53.0 16469 34252 19636 17.8% 11.8 4941 10272 17.7%  

Stats details: hammer_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.97 52.95 0.00 0.00 1.2195 0.0000 1108930.17 1108930.17 0.00 17167.16 17167.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.08 17.69% 10271.80 7977 11893 9001.03 0 11893 21355 21355 0.00
multistrike 9.67 82.31% 4940.69 3989 5947 4942.72 0 5947 47795 47795 0.00
hit 43.52 82.19% 16468.97 13295 19822 16475.28 15541 17465 716768 716768 0.00
crit 9.43 17.81% 34252.22 26590 39644 34291.20 26590 39644 323013 323013 0.00
 
DPS Timeline Chart
 

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a magical hammer that strikes an enemy for {$s1=1} Holy damage{$?s53503=false}[ and generates a charge of Holy Power][]. Only usable on enemies that have 20% or less health{$?s53503=false}[ or during Avenging Wrath][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.028000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
hand_of_light 5974 24.0% 226.4 1.62sec 7912 0 Direct 226.4 7912 0 7912 0.0% 0.0 0 0 0.0%  

Stats details: hand_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 226.43 226.43 0.00 0.00 0.0000 0.0000 1791490.92 1791490.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 226.43 100.00% 7912.05 977 28624 7926.33 6910 9245 1791491 1791491 0.00
 
DPS Timeline Chart
 

Action details: hand_of_light

Static Values
  • id:96172
  • school:holy
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31908.20
  • base_dd_max:31908.20
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
judgment 1153 4.7% 34.6 7.72sec 10038 7814 Direct 34.6 8348 16704 9412 12.7% 7.7 2504 5013 12.7%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.63 34.63 0.00 0.00 1.2846 0.0000 347576.48 347576.48 0.00 7814.22 7814.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.98 12.74% 5012.74 5004 6004 3115.04 0 6004 4900 4900 0.00
multistrike 6.70 87.26% 2504.42 2502 3002 2500.82 0 2752 16773 16773 0.00
hit 30.22 87.27% 8348.03 8339 10007 8347.86 8339 8432 252262 252262 0.00
crit 4.41 12.73% 16704.34 16679 20015 16518.75 0 20015 73642 73642 0.00
 
DPS Timeline Chart
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.empowered_seals.enabled&time<2
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Causes {$s1=1} Holy damage {$?s105424=false}[and generates 1 Holy Power]?s85256[and generates 1 Holy Power][]. Requires an active Seal to cast.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.696000
  • spell_power_mod.direct:0.576000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 2444 9.9% 99.7 3.01sec 7362 2449 Direct 99.7 5937 12361 6902 15.0% 22.2 1781 3704 15.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.74 99.74 0.00 0.00 3.0063 0.0000 734244.89 1128418.46 34.93 2448.79 2448.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.32 14.99% 3704.46 3268 4688 3565.04 0 4688 12305 18911 33.58
multistrike 18.84 85.01% 1780.69 1634 2344 1782.08 1634 2162 33549 51560 34.93
hit 84.75 84.97% 5936.56 5447 7813 5940.87 5725 6140 503099 773183 34.93
crit 14.99 15.03% 12360.70 10894 15625 12379.47 10894 15625 185292 284764 34.93
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
seal_of_truth_proc 1385 5.6% 303.6 0.99sec 1370 0 Direct 303.6 1102 2299 1284 15.2% 67.4 331 689 15.2%  

Stats details: seal_of_truth_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 303.59 303.59 0.00 0.00 0.0000 0.0000 415887.23 415887.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.26 15.23% 689.45 603 864 690.28 603 864 7075 7075 0.00
multistrike 57.13 84.77% 330.79 301 432 331.05 308 364 18898 18898 0.00
hit 257.42 84.79% 1102.43 1005 1441 1103.29 1073 1137 283791 283791 0.00
crit 46.17 15.21% 2298.70 2009 2882 2301.18 2081 2563 106124 106124 0.00
 
DPS Timeline Chart
 

Action details: seal_of_truth_proc

Static Values
  • id:31801
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31801
  • name:Seal of Truth
  • school:holy
  • tooltip:Melee attacks cause Holy damage over {$31803d=15 seconds}.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463sw1 additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R {$@spelldesc31803=Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.12
 
shattered_bleed 392 1.6% 17.6 17.35sec 6674 0 Direct 17.6 1653 3377 1911 14.9% 3.9 496 1013 15.1%  
Periodic 98.6 777 0 777 0.0% 22.0 236 0 0.0% 32.8%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.65 17.65 98.58 98.58 0.0000 1.0000 117771.48 117771.48 0.00 1194.64 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.59 15.05% 1013.06 944 1133 448.34 0 1133 599 599 0.00
multistrike 3.34 84.95% 495.93 472 566 476.79 0 566 1655 1655 0.00
hit 15.01 85.05% 1653.17 1573 1888 1652.97 1573 1825 24812 24812 0.00
crit 2.64 14.95% 3376.81 3147 3776 3146.03 0 3776 8908 8908 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 22.0 100.00% 236.01 236 236 236.01 236 236 5180 5180 0.00
hit 98.6 100.00% 777.18 1 787 777.47 748 787 76617 76617 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Ðepeche
avenging_wrath 3.0 121.10sec

Stats details: avenging_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 2.98 2.98 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.40 80.45% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.58 19.55% 0.00 0 0 0.00 0 0 0 0 0.00
 
HPS Timeline Chart
 

Action details: avenging_wrath

Static Values
  • id:31884
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:119.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ðepeche
  • harmful:false
  • if_expr:talent.seraphim.enabled
Spelldata
  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
 
draenic_strength_potion 2.0 0.00sec

Stats details: draenic_strength_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156428
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156428
  • name:Draenic Strength Potion
  • school:physical
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your strength by {$s1=1000} for {$d=25 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
avenging_wrath 3.0 0.0 121.1sec 121.1sec 28.23% 68.74% 0.0(0.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • avenging_wrath_1:28.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31884
  • name:Avenging Wrath
  • tooltip:All damage and healing caused increased by {$s1=20}%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by {$s1=20}% for {$d=20 seconds}. {$?s54927=false}|s115931[ While Avenging Wrath is active, ][]{$?s54927=false}[you heal for {$115547s1=1}% of your maximum health every $115547t sec][]{$?s54927=false}&s115931[ and ][]{$?s115931=false}[your falling speed is slowed][]{$?s54927=false}|s115931[.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_crusader 16.2 1.0 17.4sec 16.4sec 16.57% 100.00% 1.0(1.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_divine_crusader
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:0.00

Stack Uptimes

  • divine_crusader_1:16.57%

Trigger Attempt Success

  • trigger_pct:24.76%

Spelldata details

  • id:144595
  • name:Divine Crusader
  • tooltip:Your next Divine Storm is free and deals {$s2=50}% more damage.
  • description:{$@spelldesc144593=Holy Power consumers have a 25% chance to make your next Divine Storm free and deal {$144595s2=50}% more damage.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
draenic_strength_potion 2.0 0.0 122.9sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_draenic_strength_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:1000.00

Stack Uptimes

  • draenic_strength_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156428
  • name:Draenic Strength Potion
  • tooltip:Strength increased by {$s1=1000}.
  • description:Increases your strength by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
final_verdict 16.8 47.9 17.6sec 4.6sec 75.14% 75.15% 47.9(47.9)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_final_verdict
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • final_verdict_1:75.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157048
  • name:Final Verdict
  • tooltip:Damage and radius of your next Divine Storm increased by {$s3=100}%.
  • description:Empowers your weapon with holy energy, and performs a devastating strike, dealing $sw1 Holy damage. Also increases the damage and radius of your next Divine Storm by {$s3=100}%. Replaces Templar's Verdict.
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
glyph_double_jeopardy (glyph_double_jeopardy) 4.2 38.1 73.8sec 6.3sec 71.62% 71.62% 38.1(38.1)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_glyph_double_jeopardy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • glyph_double_jeopardy_1:71.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:54922
  • name:Glyph of Double Jeopardy
  • tooltip:
  • description:Judging a target increases the damage of your next Judgment by {$121027s1=20}%, but only if used on a different second target.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
selfless_healer 2.7 39.6 119.7sec 6.3sec 75.68% 75.68% 34.3(34.3)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_selfless_healer
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • selfless_healer_1:3.87%
  • selfless_healer_2:4.14%
  • selfless_healer_3:67.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114250
  • name:Selfless Healer
  • tooltip:Your next Flash of Light casts $w1% faster, costs $w3% less mana, and heals for $w2% greater effectiveness on others.
  • description:{$@spelldesc85804=Your successful Judgments reduce the cast time and mana cost of your next Flash of Light by {$114250s1=35}%, and increase its effect on others by $?c1[{$114250s4=35}][{$114250s2=20}]%. Stacks up to 3 times.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
spirit_of_the_warlords 3.0 0.0 120.7sec 120.7sec 19.02% 19.03% 0.0(0.0)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_strength_flask

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
seal_of_truth

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_seal_of_truth
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • seal_of_truth_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31801
  • name:Seal of Truth
  • tooltip:Melee attacks cause Holy damage over {$31803d=15 seconds}.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463sw1 additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R {$@spelldesc31803=Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ðepeche
crusader_strike Mana 63.3 40520.5 640.0 640.0 12.5
execution_sentence Mana 5.5 22450.2 4096.0 4095.9 16.5
exorcism Mana 9.7 12373.0 1280.0 1280.0 8.3
final_verdict Holy Power 52.9 158.8 3.0 3.0 8460.2
hammer_of_wrath Mana 53.0 50848.9 960.0 960.0 21.8
Resource Gains Type Count Total Average Overflow
external_healing Health 8.10 0.00 (0.00%) 0.00 75672.95 100.00%
sword_of_light Mana 149.64 125263.95 (100.00%) 837.09 162048.03 56.40%
crusader_strike Holy Power 63.31 63.31 (39.43%) 1.00 0.00 0.00%
exorcism Holy Power 9.67 9.67 (6.02%) 1.00 0.00 0.00%
hammer_of_wrath Holy Power 52.95 52.95 (32.98%) 1.00 0.00 0.00%
judgment Holy Power 34.63 34.63 (21.57%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 416.30 419.39
Holy Power 0.53 0.53
Combat End Resource Mean Min Max
Mana 31070.85 26944.00 32000.00
Holy Power 1.71 0.00 4.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 32.4%

Procs

Count Interval
divine_crusader 17.2 16.4sec
exorcism_cd_reset 19.9 14.5sec
wasted_exorcism_cd_reset 14.1 20.8sec

Statistics & Data Analysis

Fight Length
Sample Data Ðepeche Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Ðepeche Damage Per Second
Count 25000
Mean 24834.91
Minimum 22208.05
Maximum 27852.72
Spread ( max - min ) 5644.66
Range [ ( max - min ) / 2 * 100% ] 11.36%
Standard Deviation 788.3887
5th Percentile 23554.97
95th Percentile 26143.12
( 95th Percentile - 5th Percentile ) 2588.14
Mean Distribution
Standard Deviation 4.9862
95.00% Confidence Intervall ( 24825.14 - 24844.68 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3871
0.1 Scale Factor Error with Delta=300 5305
0.05 Scale Factor Error with Delta=300 21223
0.01 Scale Factor Error with Delta=300 530596
Distribution Chart
DPS(e)
Sample Data Ðepeche Damage Per Second (Effective)
Count 25000
Mean 24834.91
Minimum 22208.05
Maximum 27852.72
Spread ( max - min ) 5644.66
Range [ ( max - min ) / 2 * 100% ] 11.36%
Damage
Sample Data Ðepeche Damage
Count 25000
Mean 7452729.67
Minimum 5518681.98
Maximum 9406942.40
Spread ( max - min ) 3888260.42
Range [ ( max - min ) / 2 * 100% ] 26.09%
DTPS
Sample Data Ðepeche Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ðepeche Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Ðepeche Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ðepeche Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ðepeche Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ðepeche Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ÐepecheTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Ðepeche Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=sleeper_surprise
2 0.00 blessing_of_kings,if=!aura.str_agi_int.up
3 0.00 blessing_of_might,if=!aura.mastery.up
4 0.00 seal_of_truth,if=active_enemies<2
5 0.00 seal_of_righteousness,if=active_enemies>=2
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=draenic_strength
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 rebuke
9 1.00 potion,name=draenic_strength,if=(buff.bloodlust.react|buff.avenging_wrath.up|target.time_to_die<=40)
A 1.00 auto_attack
B 0.00 speed_of_light,if=movement.distance>5
C 0.00 judgment,if=talent.empowered_seals.enabled&time<2
D 5.48 execution_sentence
E 0.00 lights_hammer
F 0.00 holy_avenger,sync=seraphim,if=talent.seraphim.enabled
G 0.00 holy_avenger,if=holy_power<=2&!talent.seraphim.enabled
H 0.00 avenging_wrath,sync=seraphim,if=talent.seraphim.enabled
I 2.98 avenging_wrath,if=!talent.seraphim.enabled
J 0.00 blood_fury
K 0.00 berserking
L 0.00 arcane_torrent
M 0.00 seraphim
N 0.00 wait,sec=cooldown.seraphim.remains,if=talent.seraphim.enabled&cooldown.seraphim.remains>0&cooldown.seraphim.remains<gcd.max&holy_power>=5
O 0.00 call_action_list,name=aoe,if=active_enemies>=5
P 0.00 call_action_list,name=cleave,if=active_enemies>=3
Q 0.00 call_action_list,name=single
actions.single
# count action,conditions
R 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
S 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&active_enemies=2&!talent.final_verdict.enabled
T 0.00 divine_storm,if=holy_power=5&active_enemies=2&buff.final_verdict.up
U 0.00 divine_storm,if=buff.divine_crusader.react&holy_power=5&(talent.seraphim.enabled&cooldown.seraphim.remains<=4)
V 0.00 templars_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
W 0.00 templars_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<3
X 0.00 divine_storm,if=buff.divine_crusader.react&buff.divine_crusader.remains<3&!talent.final_verdict.enabled
Y 1.23 final_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3
Z 0.00 final_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<4
a 52.97 hammer_of_wrath
b 0.00 judgment,if=talent.empowered_seals.enabled&seal.truth&buff.maraads_truth.remains<cooldown.judgment.duration
c 0.00 judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<cooldown.judgment.duration
d 0.00 exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
e 0.00 seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.down
f 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.down&!buff.avenging_wrath.up&!buff.bloodlust.up
g 9.22 divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up&(buff.avenging_wrath.up|target.health.pct<35)
h 30.97 final_verdict,if=buff.avenging_wrath.up|target.health.pct<35
i 0.00 templars_verdict,if=buff.avenging_wrath.up|target.health.pct<35&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
j 63.31 crusader_strike,if=holy_power<5
k 0.00 divine_storm,if=buff.divine_crusader.react&(buff.avenging_wrath.up|target.health.pct<35)&!talent.final_verdict.enabled
l 6.85 divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up
m 0.00 final_verdict,if=buff.divine_purpose.react
n 9.11 final_verdict,if=holy_power>=4
o 1.00 judgment,cycle_targets=1,if=last_judgment_target!=target&glyph.double_jeopardy.enabled&holy_power<5&cooldown.seraphim.remains<=3
p 0.00 exorcism,if=glyph.mass_exorcism.enabled&active_enemies>=2&holy_power<5
q 33.63 judgment,,if=holy_power<5
r 11.63 final_verdict,if=holy_power>=3
s 0.00 exorcism,if=talent.seraphim.enabled&cooldown.seraphim.remains<=15
t 0.00 templars_verdict,if=buff.divine_purpose.react
u 0.00 divine_storm,if=buff.divine_crusader.react&!talent.final_verdict.enabled
v 0.00 templars_verdict,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)
w 0.00 seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.remains<cooldown.judgment.duration
x 0.00 seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.remains<cooldown.judgment.duration&!buff.bloodlust.up
y 9.67 exorcism,if=holy_power<5
z 0.00 templars_verdict,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>9)
{ 0.00 holy_prism

Sample Sequence

0147ADIajahajahajahajahagajahagahajahjoyjnqjrjqjryjqrjqjrjDqjryjqrjyqjnjqrjyqjnjqrjyqjnjqrjqjryjqrjDI9ajahagahajahagajahagahajqrjlqjryjqrjqjryjqrjDqjrajqhajqhajqhagjqahjqahgjahjqahjqahgjaqhgajDIqahagahajahajahagajahajahjqahgjahjqah

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre food Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre seal_of_truth Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 32000.0/32000: 100% mana | 5.0/5: 100% holy_power draenic_strength_potion
0:00.000 auto_attack Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_strength_potion
0:00.000 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power draenic_strength_potion
0:01.302 avenging_wrath Ðepeche 27904.0/32000: 87% mana | 0.0/5: 0% holy_power bloodlust, spirit_of_the_warlords, draenic_strength_potion
0:01.302 hammer_of_wrath Fluffy_Pillow 27904.0/32000: 87% mana | 0.0/5: 0% holy_power bloodlust, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:02.307 crusader_strike Fluffy_Pillow 28864.0/32000: 90% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:03.312 hammer_of_wrath Fluffy_Pillow 28224.0/32000: 88% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:04.318 final_verdict Fluffy_Pillow 29184.0/32000: 91% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:05.322 hammer_of_wrath Fluffy_Pillow 29184.0/32000: 91% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:06.325 crusader_strike Fluffy_Pillow 30144.0/32000: 94% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:07.329 hammer_of_wrath Fluffy_Pillow 29504.0/32000: 92% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:08.333 final_verdict Fluffy_Pillow 30464.0/32000: 95% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:09.337 hammer_of_wrath Fluffy_Pillow 30464.0/32000: 95% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:10.343 crusader_strike Fluffy_Pillow 31424.0/32000: 98% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:11.347 hammer_of_wrath Fluffy_Pillow 30784.0/32000: 96% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:12.353 final_verdict Fluffy_Pillow 31744.0/32000: 99% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:13.358 hammer_of_wrath Fluffy_Pillow 31744.0/32000: 99% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:14.364 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:15.366 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:16.370 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:17.374 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
0:18.379 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
0:19.383 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
0:20.387 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath
0:21.391 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath
0:22.396 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power bloodlust, avenging_wrath
0:23.403 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath, divine_crusader
0:24.407 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath, divine_crusader
0:25.411 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath
0:26.417 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath
0:27.423 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, final_verdict, avenging_wrath
0:28.429 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict, avenging_wrath
0:29.434 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power bloodlust, final_verdict, avenging_wrath
0:30.439 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, final_verdict, avenging_wrath
0:31.444 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, final_verdict
0:32.448 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, final_verdict
0:33.453 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer
0:34.457 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer
0:35.462 final_verdict Fluffy_Pillow 31360.0/32000: 98% mana | 4.0/5: 80% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer
0:36.467 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer
0:37.470 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2)
0:38.473 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2)
0:39.478 Waiting 1.000 sec 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2)
0:40.478 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power bloodlust, glyph_double_jeopardy, final_verdict, selfless_healer(2)
0:41.482 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
0:42.787 Waiting 0.700 sec 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:43.487 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:44.791 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:46.094 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:47.399 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:48.703 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:50.007 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:51.310 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:52.616 Waiting 1.300 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:53.916 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:55.222 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:56.525 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:57.830 Waiting 1.300 sec 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
0:59.130 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:00.435 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:01.741 judgment Fluffy_Pillow 27904.0/32000: 87% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:03.045 crusader_strike Fluffy_Pillow 29824.0/32000: 93% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:04.351 final_verdict Fluffy_Pillow 31104.0/32000: 97% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:05.654 exorcism Fluffy_Pillow 31104.0/32000: 97% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:06.959 crusader_strike Fluffy_Pillow 31744.0/32000: 99% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:08.263 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:09.565 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:10.869 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:12.174 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:13.479 judgment Fluffy_Pillow 30720.0/32000: 96% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:14.783 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:16.088 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:17.391 Waiting 1.300 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:18.691 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:19.995 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:21.301 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:22.606 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:23.910 Waiting 0.900 sec 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:24.810 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:26.116 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:27.419 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:28.723 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:30.027 Waiting 1.300 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:31.327 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:32.632 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:33.937 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:35.242 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:36.547 Waiting 0.700 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:37.247 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:38.550 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:39.854 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:41.159 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:42.462 Waiting 1.300 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:43.762 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:45.066 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:46.370 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:47.676 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:48.982 Waiting 1.300 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:50.282 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:51.586 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:52.890 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:54.194 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:55.498 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:56.802 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:58.107 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
1:59.411 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), spirit_of_the_warlords
2:00.716 execution_sentence Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), spirit_of_the_warlords
2:02.020 avenging_wrath Ðepeche 29824.0/32000: 93% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), spirit_of_the_warlords
2:02.020 potion Fluffy_Pillow 29824.0/32000: 93% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
2:02.020 hammer_of_wrath Fluffy_Pillow 29824.0/32000: 93% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:03.325 crusader_strike Fluffy_Pillow 28864.0/32000: 90% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:04.629 hammer_of_wrath Fluffy_Pillow 30144.0/32000: 94% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:05.933 final_verdict Fluffy_Pillow 29184.0/32000: 91% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:07.237 hammer_of_wrath Fluffy_Pillow 31104.0/32000: 97% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
2:08.542 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
2:09.849 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power selfless_healer(3), avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:11.154 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power selfless_healer(3), avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:12.459 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:13.763 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:15.069 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:16.374 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, avenging_wrath, spirit_of_the_warlords, draenic_strength_potion
2:17.678 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, avenging_wrath, divine_crusader, spirit_of_the_warlords, draenic_strength_potion
2:18.982 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, divine_crusader, draenic_strength_potion
2:20.287 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, divine_crusader, draenic_strength_potion
2:21.592 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power avenging_wrath, divine_crusader, draenic_strength_potion
2:22.897 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, divine_crusader, draenic_strength_potion
2:24.201 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power avenging_wrath, divine_crusader, draenic_strength_potion
2:25.506 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, divine_crusader, draenic_strength_potion
2:26.810 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath, divine_crusader, draenic_strength_potion
2:28.116 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power avenging_wrath
2:29.419 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 3.0/5: 60% holy_power avenging_wrath
2:30.724 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, avenging_wrath
2:32.029 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict
2:33.334 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power final_verdict
2:34.638 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
2:35.944 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer, divine_crusader
2:37.248 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer, divine_crusader
2:38.551 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer
2:39.855 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
2:41.161 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
2:42.466 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:43.771 crusader_strike Fluffy_Pillow 30720.0/32000: 96% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:45.076 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:46.380 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:47.683 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:48.987 Waiting 1.300 sec 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:50.287 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:51.590 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:52.893 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:54.197 Waiting 1.100 sec 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:55.297 exorcism Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:56.603 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:57.907 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
2:59.213 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:00.517 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:01.820 execution_sentence Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:03.127 judgment Fluffy_Pillow 29184.0/32000: 91% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:04.432 crusader_strike Fluffy_Pillow 31104.0/32000: 97% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:05.735 final_verdict Fluffy_Pillow 30464.0/32000: 95% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:07.038 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:08.341 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:09.647 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:10.954 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:12.257 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:13.561 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:14.865 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:16.168 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:17.473 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:18.779 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:20.083 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:21.388 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:22.692 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:23.998 divine_storm Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:25.303 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3)
3:26.608 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
3:27.911 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
3:29.217 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, selfless_healer(3)
3:30.523 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:31.829 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:33.135 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:34.439 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:35.744 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:37.050 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3)
3:38.355 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3)
3:39.657 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3)
3:40.962 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:42.267 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3)
3:43.570 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:44.873 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:46.178 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:47.482 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:48.787 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:50.090 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3)
3:51.395 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader
3:52.700 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
3:54.005 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader
3:55.308 judgment Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader, spirit_of_the_warlords
3:56.612 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader, spirit_of_the_warlords
3:57.918 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), divine_crusader, spirit_of_the_warlords
3:59.224 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader, spirit_of_the_warlords
4:00.526 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader, spirit_of_the_warlords
4:01.830 execution_sentence Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader, spirit_of_the_warlords
4:03.135 avenging_wrath Ðepeche 29184.0/32000: 91% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), divine_crusader, spirit_of_the_warlords
4:03.135 judgment Fluffy_Pillow 29184.0/32000: 91% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords
4:04.440 hammer_of_wrath Fluffy_Pillow 31104.0/32000: 97% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords
4:05.744 final_verdict Fluffy_Pillow 30144.0/32000: 94% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords
4:07.050 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords
4:08.354 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, divine_crusader, spirit_of_the_warlords
4:09.657 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
4:10.960 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
4:12.264 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
4:13.567 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer(3), avenging_wrath, spirit_of_the_warlords
4:14.873 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:16.178 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:17.483 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, selfless_healer(3), avenging_wrath
4:18.788 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath
4:20.094 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath
4:21.399 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 3.0/5: 60% holy_power final_verdict, avenging_wrath
4:22.705 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power final_verdict, avenging_wrath, divine_crusader
4:24.010 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath, divine_crusader
4:25.315 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power avenging_wrath
4:26.621 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power avenging_wrath
4:27.928 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 3.0/5: 60% holy_power avenging_wrath
4:29.232 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power avenging_wrath
4:30.539 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict, avenging_wrath
4:31.843 crusader_strike Fluffy_Pillow 31040.0/32000: 97% mana | 2.0/5: 40% holy_power final_verdict, avenging_wrath
4:33.145 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power final_verdict
4:34.448 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 4.0/5: 80% holy_power final_verdict
4:35.754 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power final_verdict
4:37.059 judgment Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power final_verdict
4:38.363 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
4:39.668 final_verdict Fluffy_Pillow 31040.0/32000: 97% mana | 4.0/5: 80% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
4:40.971 divine_storm Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, final_verdict, selfless_healer, divine_crusader
4:42.276 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 1.0/5: 20% holy_power glyph_double_jeopardy, selfless_healer
4:43.580 hammer_of_wrath Fluffy_Pillow 31360.0/32000: 98% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, selfless_healer
4:44.884 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, selfless_healer
4:46.187 crusader_strike Fluffy_Pillow 32000.0/32000: 100% mana | 0.0/5: 0% holy_power glyph_double_jeopardy, final_verdict, selfless_healer
4:47.493 judgment Fluffy_Pillow 31360.0/32000: 98% mana | 1.0/5: 20% holy_power final_verdict, selfless_healer
4:48.798 hammer_of_wrath Fluffy_Pillow 32000.0/32000: 100% mana | 2.0/5: 40% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)
4:50.103 final_verdict Fluffy_Pillow 32000.0/32000: 100% mana | 3.0/5: 60% holy_power glyph_double_jeopardy, final_verdict, selfless_healer(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4545 4065 3945 (1537)
Agility 477 455 455
Stamina 4427 4025 4025
Intellect 1094 1042 1042
Spirit 782 782 782
Health 265620 241500 0
Mana 32000 32000 0
Holy Power 5 5 0
Spell Power 5000 4065 0
Crit 15.47% 10.47% 602
Haste 15.30% 9.81% 981
Multistrike 11.12% 6.12% 404
Damage / Heal Versatility 4.89% 1.89% 246
Attack Power 5000 4065 0
Mastery 53.39% 39.44% 1048
Armor 1983 1983 1983

Talents

Level
15 Speed of Light Long Arm of the Law Pursuit of Justice
30 Fist of Justice Repentance Blinding Light
45 Selfless Healer Eternal Flame Sacred Shield
60 Hand of Purity Unbreakable Spirit Clemency
75 Holy Avenger Sanctified Wrath Divine Purpose
90 Holy Prism Light's Hammer Execution Sentence
100 Empowered Seals Seraphim Final Verdict (Retribution Paladin)

Profile

paladin="Ðepeche"
origin="http://eu.battle.net/wow/en/character/forscherliga/Ðepeche/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/95/55886431-avatar.jpg"
level=100
race=human
role=attack
position=back
professions=jewelcrafting=700/blacksmithing=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#bb!2001122
glyphs=hand_of_sacrifice/double_jeopardy/templars_verdict/seal_of_blood/winged_vengeance/righteous_retreat
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_strength_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/blessing_of_kings,if=!aura.str_agi_int.up
actions.precombat+=/blessing_of_might,if=!aura.mastery.up
actions.precombat+=/seal_of_truth,if=active_enemies<2
actions.precombat+=/seal_of_righteousness,if=active_enemies>=2
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_strength

# Executed every time the actor is available.

actions=rebuke
actions+=/potion,name=draenic_strength,if=(buff.bloodlust.react|buff.avenging_wrath.up|target.time_to_die<=40)
actions+=/auto_attack
actions+=/speed_of_light,if=movement.distance>5
actions+=/judgment,if=talent.empowered_seals.enabled&time<2
actions+=/execution_sentence
actions+=/lights_hammer
actions+=/holy_avenger,sync=seraphim,if=talent.seraphim.enabled
actions+=/holy_avenger,if=holy_power<=2&!talent.seraphim.enabled
actions+=/avenging_wrath,sync=seraphim,if=talent.seraphim.enabled
actions+=/avenging_wrath,if=!talent.seraphim.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/seraphim
actions+=/wait,sec=cooldown.seraphim.remains,if=talent.seraphim.enabled&cooldown.seraphim.remains>0&cooldown.seraphim.remains<gcd.max&holy_power>=5
actions+=/call_action_list,name=aoe,if=active_enemies>=5
actions+=/call_action_list,name=cleave,if=active_enemies>=3
actions+=/call_action_list,name=single

actions.single=divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&active_enemies=2&!talent.final_verdict.enabled
actions.single+=/divine_storm,if=holy_power=5&active_enemies=2&buff.final_verdict.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&(talent.seraphim.enabled&cooldown.seraphim.remains<=4)
actions.single+=/templars_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>5)
actions.single+=/templars_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<3
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.divine_crusader.remains<3&!talent.final_verdict.enabled
actions.single+=/final_verdict,if=holy_power=5|buff.holy_avenger.up&holy_power>=3
actions.single+=/final_verdict,if=buff.divine_purpose.react&buff.divine_purpose.remains<4
actions.single+=/hammer_of_wrath
actions.single+=/judgment,if=talent.empowered_seals.enabled&seal.truth&buff.maraads_truth.remains<cooldown.judgment.duration
actions.single+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<cooldown.judgment.duration
actions.single+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.single+=/seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.down
actions.single+=/seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.down&!buff.avenging_wrath.up&!buff.bloodlust.up
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up&(buff.avenging_wrath.up|target.health.pct<35)
actions.single+=/final_verdict,if=buff.avenging_wrath.up|target.health.pct<35
actions.single+=/templars_verdict,if=buff.avenging_wrath.up|target.health.pct<35&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
actions.single+=/crusader_strike,if=holy_power<5
actions.single+=/divine_storm,if=buff.divine_crusader.react&(buff.avenging_wrath.up|target.health.pct<35)&!talent.final_verdict.enabled
actions.single+=/divine_storm,if=buff.divine_crusader.react&buff.final_verdict.up
actions.single+=/final_verdict,if=buff.divine_purpose.react
actions.single+=/final_verdict,if=holy_power>=4
actions.single+=/judgment,cycle_targets=1,if=last_judgment_target!=target&glyph.double_jeopardy.enabled&holy_power<5&cooldown.seraphim.remains<=3
actions.single+=/exorcism,if=glyph.mass_exorcism.enabled&active_enemies>=2&holy_power<5
actions.single+=/judgment,,if=holy_power<5
actions.single+=/final_verdict,if=holy_power>=3
actions.single+=/exorcism,if=talent.seraphim.enabled&cooldown.seraphim.remains<=15
actions.single+=/templars_verdict,if=buff.divine_purpose.react
actions.single+=/divine_storm,if=buff.divine_crusader.react&!talent.final_verdict.enabled
actions.single+=/templars_verdict,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)
actions.single+=/seal_of_truth,if=talent.empowered_seals.enabled&buff.maraads_truth.remains<cooldown.judgment.duration
actions.single+=/seal_of_righteousness,if=talent.empowered_seals.enabled&buff.liadrins_righteousness.remains<cooldown.judgment.duration&!buff.bloodlust.up
actions.single+=/exorcism,if=holy_power<5
actions.single+=/templars_verdict,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>9)
actions.single+=/holy_prism

actions.cleave=final_verdict,if=buff.final_verdict.down&holy_power=5
actions.cleave+=/divine_storm,if=buff.divine_crusader.react&holy_power=5&buff.final_verdict.up
actions.cleave+=/divine_storm,if=holy_power=5&buff.final_verdict.up
actions.cleave+=/divine_storm,if=holy_power=5&(!talent.seraphim.enabled|cooldown.seraphim.remains>4)&!talent.final_verdict.enabled
actions.cleave+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.cleave+=/hammer_of_wrath
actions.cleave+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<=5
actions.cleave+=/divine_storm,if=holy_power>=4&(!talent.seraphim.enabled|cooldown.seraphim.remains>6)&!talent.final_verdict.enabled
actions.cleave+=/crusader_strike
actions.cleave+=/divine_storm,if=holy_power>=3&(!talent.seraphim.enabled|cooldown.seraphim.remains>7)&!talent.final_verdict.enabled
actions.cleave+=/final_verdict,if=buff.final_verdict.down
actions.cleave+=/divine_storm,if=buff.final_verdict.up
actions.cleave+=/exorcism,if=glyph.mass_exorcism.enabled
actions.cleave+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled
actions.cleave+=/judgment
actions.cleave+=/exorcism

actions.aoe=divine_storm,if=holy_power=5&(!talent.seraphim.enabled|cooldown.seraphim.remains>4)
actions.aoe+=/exorcism,if=buff.blazing_contempt.up&holy_power<=2&buff.holy_avenger.down
actions.aoe+=/hammer_of_wrath
actions.aoe+=/hammer_of_the_righteous
actions.aoe+=/judgment,if=talent.empowered_seals.enabled&seal.righteousness&buff.liadrins_righteousness.remains<=5
actions.aoe+=/divine_storm,if=(!talent.seraphim.enabled|cooldown.seraphim.remains>6)
actions.aoe+=/exorcism,if=glyph.mass_exorcism.enabled
actions.aoe+=/holy_prism,target=self
actions.aoe+=/judgment,cycle_targets=1,if=glyph.double_jeopardy.enabled
actions.aoe+=/judgment
actions.aoe+=/exorcism

head=casque_of_the_iron_bomber,id=113600,bonus_id=566
neck=spirewalkers_chain,id=114540,bonus_id=134,enchant=40mastery
shoulders=primal_gladiators_scaled_shoulders,id=115700
back=cloak_of_ruminant_deception,id=113830,bonus_id=566,enchant=gift_of_mastery
chest=rivetsealed_breastplate,id=109896,bonus_id=524
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=bouldercrush_vambraces,id=118954,bonus_id=78
hands=exceptional_crystalplated_gauntlets,id=115390
waist=fleshchewer_greatbelt,id=113659
legs=legplates_of_fractured_crystal,id=113648,bonus_id=566
feet=crazed_bombers_greaves,id=114504,bonus_id=487
finger1=grunts_solid_signet,id=113599,bonus_id=566,enchant=50mastery
finger2=timeless_solium_band_of_brutality,id=118295,enchant=50mastery
trinket1=skull_of_war,id=112318,bonus_id=525/530
trinket2=mote_of_corruption,id=110010,bonus_id=524
main_hand=blood_gutter_greatsword,id=115418,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_strength=2418
# gear_stamina=3135
# gear_crit_rating=602
# gear_haste_rating=981
# gear_mastery_rating=998
# gear_armor=1983
# gear_multistrike_rating=404
# gear_versatility_rating=146

Swæty

Swæty : 21494 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
21493.6 21493.6 6.8 / 0.031% 2135.3 / 9.9% 54.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
389.1 389.1 Mana 0.00% 40.1 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Swæty/advanced
Talents
  • 15: Angelic Bulwark
  • 30: Body and Soul
  • 45: Insanity (Shadow Priest)
  • 60: Dominate Mind
  • 75: Shadowy Insight (Shadow Priest)
  • 90: Halo (Shadow Priest)
  • 100: Clarity of Power (Shadow Priest)
  • Talent Calculator
Glyphs
  • Glyph of Fade
  • Glyph of Mind Blast
  • Glyph of Mind Flay
  • Glyph of Dark Archangel
  • Glyph of the Heavens
  • Glyph of Shadow Ravens
Professions
  • mining: 700
  • enchanting: 682

Charts

http://9.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Sw%C3%A6ty+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x270&chd=t:41774|28380|26676|23724|22691|21918|15168|13605&chds=0,83548&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++41774++devouring_plague,9482C9,0,0,15|t++28380++shadow_word_pain,9482C9,1,0,15|t++26676++shadow_word_death,9482C9,2,0,15|t++23724++halo,9482C9,3,0,15|t++22691++mind_blast,9482C9,4,0,15|t++21918++vampiric_touch,9482C9,5,0,15|t++15168++mind_spike,4A79D3,6,0,15|t++13605++insanity,9482C9,7,0,15& http://0.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Sw%C3%A6ty+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:27,20,15,10,9,7,4,3,3,2,2,1&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,9482C9&chl=mind_blast|mind_spike|insanity|devouring_plague|devouring_plague_tick|shadow_word_death|shadow_word_pain|vampiric_touch|halo_damage|shadowfiend: melee|shattered_bleed|shadowy_apparitions&
http://2.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Sw%C3%A6ty+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:knrwxzz2782535525531241y0121y12zyyxvsqqoolnnnmnonnnopoooprqqppppnmllmkjihiijjjkmmmmmooppopqrqpppponmmllkjjjjjkkklmmmmnoooooppqpppoonmmlllkkjkkklllmmmnnnooooopppooonnmmlllkkjjjklllmnnoppppqqrrsstttssrrrqqpppqppqqqqqqqrrrrsssttttttsssssrrrrrrrrrsssssttttuuuuuvvvvvvvvvvvvvvvvvvvwwwwwwwxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyyzzzzzzzzzzzzzzyyyyyxxxwwwvvvuutssrqppnmkigdbZXUSQ&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.733097,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=21494|max=29319&chxp=1,1,73,100 http://5.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Sw%C3%A6ty+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,2,1,5,9,18,45,64,93,188,261,385,508,680,823,1034,1224,1427,1487,1603,1670,1638,1603,1548,1363,1305,1126,1037,818,648,567,444,346,265,199,147,119,88,62,46,34,27,10,9,11,5,2,2,3&chds=0,1670&chbh=5&chxt=x&chxl=0:|min=19444|avg=21494|max=23922&chxp=0,1,46,100& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Sw%C3%A6ty+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:28.0,24.7,22.5,9.6,5.1,3.3,3.3,2.9,0.8&chds=0,100&chdls=ffffff&chco=4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_spike 84.3s|mind_blast 74.3s|insanity 67.6s|devouring_plague 28.8s|shadow_word_death 15.5s|shadow_word_pain 10.0s|vampiric_touch 9.8s|halo 8.8s|shadowfiend 2.4s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Swæty 21494
devouring_plague 2018 (4002) 9.4% (18.6%) 21.7 13.28sec 55402 41774 Direct 21.7 22033 44070 26156 18.7% 4.9 6612 13213 18.9%  

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.73 21.73 0.00 0.00 1.3262 0.0000 607139.66 607139.66 0.00 41774.07 41774.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.93 18.88% 13212.79 12821 15723 7981.42 0 15723 12276 12276 0.00
multistrike 3.99 81.12% 6611.54 6411 7862 6495.47 0 7862 26396 26396 0.00
hit 17.67 81.29% 22033.39 21368 26206 22046.30 21368 23518 389263 389263 0.00
crit 4.07 18.71% 44070.29 42737 52411 43545.31 0 52411 179205 179205 0.00
 
DPS Timeline Chart
 

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=5&talent.surge_of_darkness.enabled
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:
  • description:Consumes 3 Shadow Orbs to deal {$s1=2869} Shadow damage and then an additional {$s2=100}% of the initial damage over {$158831d=6 seconds}. Heals the caster for {$s3=100}% of damage done.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    devouring_plague_tick 1984 9.2% 26.7 10.72sec 22394 0 Periodic 159.3 3747 0 3747 0.0% 0.0 0 0 0.0% 38.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.65 0.00 132.65 159.31 0.0000 0.8805 596914.26 0.00 0.00 5110.70 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 159.3 100.00% 3746.87 0 11980 3749.02 3091 5147 596914 0 0.00
 
DPS Timeline Chart
 

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:
  • description:Consumes 3 Shadow Orbs to deal {$s1=2869} Shadow damage and then an additional {$s2=100}% of the initial damage over {$158831d=6 seconds}. Heals the caster for {$s3=100}% of damage done.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
halo 0 (692) 0.0% (3.2%) 6.7 48.26sec 31075 23724

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.69 6.69 0.00 0.00 1.3098 0.0000 0.00 0.00 0.00 23724.41 23724.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.44 81.31% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.25 18.69% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled&target.distance<=30&active_enemies>2
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s1=3120} Shadow damage to enemies, with the greatest effect at 25 yds.
 
    halo_damage 692 3.2% 6.7 48.26sec 31075 0 Direct 6.7 24466 48958 29103 18.9% 1.5 7336 14694 18.5%  

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.69 6.69 0.00 0.00 0.0000 0.0000 207754.63 207754.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.28 18.53% 14694.23 13947 17105 3638.44 0 17105 4126 4126 0.00
multistrike 1.23 81.47% 7336.32 6974 8553 5309.85 0 8553 9055 9055 0.00
hit 5.42 81.07% 24466.22 23246 28509 24499.99 23246 28509 132605 132605 0.00
crit 1.27 18.93% 48958.16 46491 57018 36875.41 0 57018 61969 61969 0.00
 
DPS Timeline Chart
 

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s1=3120} Shadow damage to enemies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.264000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
insanity 3056 14.2% 35.3 7.88sec 26059 13605 Periodic 94.9 7636 15272 9071 18.8% 21.5 2291 4581 18.7% 20.7%

Stats details: insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.28 35.28 94.92 94.92 1.9154 0.6572 919451.09 919451.09 0.00 13604.97 13604.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.0 18.68% 4581.46 4505 5525 4487.28 0 5525 18409 18409 0.00
multistrike 17.5 81.32% 2290.90 2253 2763 2291.81 2253 2559 40084 40084 0.00
hit 77.1 81.22% 7636.36 7509 9209 7639.39 7509 7866 588678 588678 0.00
crit 17.8 18.78% 15272.09 15017 18417 15278.12 15017 16960 272280 272280 0.00
 
DPS Timeline Chart
 

Action details: insanity

Static Values
  • id:129197
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1600.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2
Spelldata
  • id:129197
  • name:Insanity
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=true}[. Each time Mind Flay deals damage the Priest will be granted {$120587s1=15}% increased movement speed for {$120587d=5 seconds}, stacking up to {$120587u=3} times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
mind_blast 5608 26.1% 56.8 5.34sec 29657 22691 Direct 56.8 23379 46754 27769 18.8% 12.9 7015 14025 18.9%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.81 56.81 0.00 0.00 1.3070 0.0000 1684954.48 1684954.48 0.00 22691.16 22691.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.43 18.86% 14024.67 13517 16577 12773.75 0 16577 34042 34042 0.00
multistrike 10.45 81.14% 7014.55 6758 8288 7017.14 0 8288 73272 73272 0.00
hit 46.14 81.22% 23378.62 22528 27628 23392.24 22745 24111 1078798 1078798 0.00
crit 10.67 18.78% 46754.09 45056 55256 46783.26 45056 55256 498842 498842 0.00
 
DPS Timeline Chart
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:6.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:glyph.mind_harvest.enabled&shadow_orb<=2&active_enemies<=5&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=1722} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.{$?s162532=false}[ The first time you hit an enemy with Mind Blast, you gain {$162532s1=2} additional $LOrb:Orbs;.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
mind_spike 4259 19.8% 67.0 4.39sec 19074 15168 Direct 67.0 15042 30077 17861 18.8% 15.2 4512 9024 18.8%  

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.04 67.04 0.00 0.00 1.2575 0.0000 1278757.85 1278757.85 0.00 15168.23 15168.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.85 18.77% 9023.85 6196 10638 8470.66 0 10638 25708 25708 0.00
multistrike 12.33 81.23% 4512.31 3098 5319 4514.50 3098 5319 55637 55637 0.00
hit 54.47 81.25% 15041.51 10327 17730 15049.58 14472 15647 819306 819306 0.00
crit 12.57 18.75% 30077.50 20653 35460 30093.70 26161 35460 378106 378106 0.00
 
DPS Timeline Chart
 

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:191.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=790} Shadowfrost damage, but extinguishes your damage over time effects on the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.825000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shadow_word_death 1371 6.4% 11.4 5.38sec 36184 26676 Direct 11.4 28539 57100 33901 18.8% 2.5 8564 17130 19.1%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.39 11.39 0.00 0.00 1.3565 0.0000 412222.44 412229.86 0.00 26675.88 26675.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.49 19.14% 17130.27 11537 19809 6676.19 0 19809 8358 8358 0.00
multistrike 2.06 80.86% 8564.42 5768 9904 7514.95 0 9904 17655 17656 0.01
hit 9.25 81.23% 28539.31 19229 33016 28568.37 21152 33016 264098 264103 0.00
crit 2.14 18.77% 57100.21 38458 66032 51606.42 0 66032 122112 122113 0.00
 
DPS Timeline Chart
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:800.0
  • cooldown:8.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<20&shadow_orb<=4
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=1548} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}&!s157218[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shadow_word_pain 811 (940) 3.8% (4.4%) 7.6 30.76sec 37133 28380 Direct 7.6 3483 6964 4133 18.7% 1.7 1045 2090 19.0%  
Periodic 50.8 3250 6501 3862 18.8% 11.5 1016 2031 18.6% 44.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.61 7.61 50.84 50.84 1.3085 2.6191 243808.79 243808.79 0.00 1975.59 28379.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.33 18.97% 2089.96 2030 2490 584.23 0 2490 683 683 0.00
multistrike 1.40 81.03% 1044.50 1015 1245 795.02 0 1245 1458 1458 0.00
hit 6.19 81.34% 3483.45 3384 4150 3485.57 0 4150 21575 21575 0.00
crit 1.42 18.66% 6964.26 6768 8300 5478.33 0 8300 9894 9894 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.1 18.62% 2031.24 2030 2490 1783.27 0 2490 4345 4345 0.00
multistrike 9.4 81.38% 1015.69 1015 1245 1015.64 0 1130 9498 9498 0.00
hit 41.3 81.17% 3249.84 140 4150 3250.43 3151 3420 134110 134110 0.00
crit 9.6 18.83% 6501.43 280 8300 6501.86 0 7279 62245 62245 0.00
 
DPS Timeline Chart
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.auspicious_spirits.enabled&remains<(18*0.3)&miss_react
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w2 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes {$s1=455} Shadow damage and an additional $o2 Shadow damage over {$d=18 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.475000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.475000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    shadowy_apparitions 129 0.6% 9.6 22.15sec 4067 0 Direct 9.6 3206 6412 3809 18.8% 2.2 962 1924 18.6%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.57 9.57 0.00 0.00 0.0000 0.0000 38938.23 38938.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.40 18.58% 1923.70 1923 2358 630.23 0 2358 774 774 0.00
multistrike 1.76 81.42% 961.91 961 1179 786.23 0 1179 1695 1695 0.00
hit 7.77 81.19% 3206.19 3205 3930 3205.44 0 3688 24923 24923 0.00
crit 1.80 18.81% 6412.43 6409 7861 5329.86 0 7861 11546 11546 0.00
 
DPS Timeline Chart
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=430} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
shattered_bleed 384 1.8% 17.0 17.96sec 6780 0 Direct 17.0 1596 3192 1896 18.8% 3.9 479 958 18.9%  
Periodic 95.9 789 0 789 0.0% 21.7 239 0 0.0% 31.9%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.02 17.02 95.94 95.94 0.0000 1.0000 115364.13 115364.13 0.00 1202.52 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.73 18.94% 957.74 958 958 495.84 0 958 701 701 0.00
multistrike 3.13 81.06% 478.87 479 479 456.48 0 479 1500 1500 0.00
hit 13.82 81.20% 1596.23 1596 1596 1596.23 1596 1596 22056 22056 0.00
crit 3.20 18.80% 3192.46 3192 3192 3067.57 0 3192 10211 10211 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 21.7 100.00% 239.43 239 239 239.43 239 239 5200 5200 0.00
hit 95.9 100.00% 789.03 1 798 789.31 758 798 75697 75697 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
vampiric_touch 714 3.3% 7.5 31.43sec 28767 21918 Periodic 43.1 3906 7809 4639 18.8% 9.8 1251 2501 18.8% 37.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.46 7.46 43.12 43.12 1.3125 2.6199 214552.07 214552.07 0.00 1747.75 21917.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.46 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.8 18.79% 2501.39 2500 3066 2086.75 0 3066 4586 4586 0.00
multistrike 7.9 81.21% 1250.73 1250 1533 1250.32 0 1533 9913 9913 0.00
hit 35.0 81.20% 3905.77 882 5111 3906.78 3664 4167 136762 136762 0.00
crit 8.1 18.80% 7808.72 1763 10221 7807.01 0 9278 63292 63292 0.00
 
DPS Timeline Chart
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:608.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<(15*0.3+cast_time)&miss_react&active_enemies<=5
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.585000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - shadowfiend 5752 / 468
melee 5752 2.1% 20.0 10.56sec 6912 6210 Direct 20.0 5448 10899 6474 18.8% 4.5 1634 3270 18.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.03 20.03 0.00 0.00 1.1131 0.0000 138443.75 138443.75 0.00 6209.91 6209.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.85 18.68% 3270.44 2564 3616 1871.66 0 3616 2764 2764 0.00
multistrike 3.68 81.32% 1634.29 1282 1808 1598.23 0 1808 6015 6015 0.00
hit 16.26 81.18% 5448.04 4273 6026 5448.20 5111 6026 88584 88584 0.00
crit 3.77 18.82% 10899.26 8546 12053 10722.08 0 12053 41080 41080 0.00
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Swæty
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
shadowfiend 2.0 187.54sec

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.02 2.02 0.00 0.00 1.2019 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.64 81.34% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.38 18.66% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Lasts {$d=12 seconds}.
 
shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.81 80.75% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.19 19.25% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadowform

Static Values
  • id:15473
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4160.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:15473
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s3=100}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}% and increasing your armor by {$s3=100}%. However, you may not cast any healing spells while in this form.
 
pet - shadowfiend
shadowcrawl 6.0 40.44sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.02 6.02 0.00 0.00 1.2018 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.90 81.41% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.12 18.59% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 37.51% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_intellect_potion 2.0 0.0 260.5sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
glyph_of_mind_flay 1.0 93.9 0.0sec 2.9sec 91.99% 91.99% 93.9(93.9)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_glyph_of_mind_flay
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • glyph_of_mind_flay_1:91.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120585
  • name:Glyph of Mind Flay
  • tooltip:
  • description:Your Mind Flay spell no longer slows your victim's movement speed. Instead, each time Mind Flay deals damage you will be granted {$120587s1=15}% increased movement speed for {$120587d=5 seconds}, stacking up to {$120587u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadow_word_death_reset_cooldown 5.8 0.0 11.4sec 11.4sec 16.06% 49.51% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:16.06%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_insanity 21.7 0.0 13.3sec 13.3sec 37.59% 31.36% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadow_word_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_insanity_1:37.59%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowy_insight 5.8 0.1 38.0sec 37.0sec 2.07% 10.10% 0.0(0.0)

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadowy_insight
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • shadowy_insight_1:2.06%
  • shadowy_insight_2:0.00%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:162452
  • name:Shadowy Insight
  • tooltip:
  • description:Your Shadow Word: Pain damage over time and Mind Spike damage has a {$s4=5}% chance to reset the cooldown on Mind Blast and make your next Mind Blast instant.
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
(shadowfiend-) shadowfiend-shadowcrawl 6.0 0.0 40.4sec 40.4sec 83.35% 80.02% 0.0(0.0)

Buff details

  • buff initial source:Swæty_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
shadowform

Buff details

  • buff initial source:Swæty
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by {$s2=25}%. Armor increased by {$s3=100}%.
  • description:Assume a Shadowform, increasing your Shadow damage by {$s2=25}% and increasing your armor by {$s3=100}%. However, you may not cast any healing spells while in this form.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Swæty
devouring_plague Shadow Orb 21.7 65.2 3.0 3.0 18467.2
halo Mana 6.7 10697.0 1600.0 1600.0 19.4
insanity Mana 35.3 56453.0 1600.0 1600.0 16.3
mind_blast Mana 56.8 20424.0 359.5 359.5 82.5
mind_spike Mana 67.0 12804.8 191.0 191.0 99.9
shadow_word_death Mana 11.4 9113.8 800.0 800.0 45.2
shadow_word_pain Mana 7.6 3045.8 400.0 400.0 92.8
vampiric_touch Mana 7.5 4534.6 608.0 608.0 47.3
Resource Gains Type Count Total Average Overflow
Devouring Plague Health Health 159.31 0.00 (0.00%) 0.00 1204046.44 100.00%
Shadow Orbs from Mind Blast Shadow Orb 56.81 56.81 (83.30%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 11.39 11.39 (16.70%) 1.00 0.00 0.00%
mp5_regen Mana 199.26 116224.58 (100.00%) 583.27 75848.15 39.49%
Resource RPS-Gain RPS-Loss
Mana 386.26 389.08
Shadow Orb 0.23 0.22
Combat End Resource Mean Min Max
Mana 159164.85 156800.00 160000.00
Shadow Orb 3.01 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 34.3%
shadowfiend-Mana Cap 34.3%
mindbender-Mana Cap 34.3%

Procs

Count Interval
Shadowy Apparition Procced 9.6 22.1sec
Shadowy Insight Mind Blast CD Reset 5.9 37.0sec
Shadowy Insight Mind Blast CD Reset from Mind Spike 3.3 56.7sec
Shadowy Insight Mind Blast CD Reset from Shadow Word: Pain 2.6 52.7sec
Shadowy Insight Mind Blast CD Reset lost to overflow 0.0 0.0sec
Mind Spike removed DoTs 1.6 86.7sec
Mind Spike removed Devouring Plague 0.0 0.0sec
Mind Spike removed Shadow Word: Pain 1.6 86.4sec
Mind Spike removed Vampiric Touch 1.5 85.5sec
Devouring Plague ticks lost from Mind Spike removal 0.0 0.0sec
Shadow Word: Pain ticks lost from Mind Spike removal 3.5 86.4sec
Vampiric Touch ticks lost from Mind Spike removal 2.8 85.5sec

Statistics & Data Analysis

Fight Length
Sample Data Swæty Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Swæty Damage Per Second
Count 25000
Mean 21493.64
Minimum 19444.33
Maximum 23921.63
Spread ( max - min ) 4477.30
Range [ ( max - min ) / 2 * 100% ] 10.42%
Standard Deviation 544.6994
5th Percentile 20641.93
95th Percentile 22429.17
( 95th Percentile - 5th Percentile ) 1787.24
Mean Distribution
Standard Deviation 3.4450
95.00% Confidence Intervall ( 21486.88 - 21500.39 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2467
0.1 Scale Factor Error with Delta=300 2532
0.05 Scale Factor Error with Delta=300 10131
0.01 Scale Factor Error with Delta=300 253278
Distribution Chart
DPS(e)
Sample Data Swæty Damage Per Second (Effective)
Count 25000
Mean 21493.64
Minimum 19444.33
Maximum 23921.63
Spread ( max - min ) 4477.30
Range [ ( max - min ) / 2 * 100% ] 10.42%
Damage
Sample Data Swæty Damage
Count 25000
Mean 6319857.63
Minimum 4708807.55
Maximum 8140786.91
Spread ( max - min ) 3431979.36
Range [ ( max - min ) / 2 * 100% ] 27.15%
DTPS
Sample Data Swæty Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Swæty Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Swæty Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Swæty Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Swæty Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Swæty Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data SwætyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Swæty Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Devouring Plague ticks lost from Mind Spike removal
Sample Data Devouring Plague ticks lost from Mind Spike removal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 1.00
Spread ( max - min ) 1.00
Range [ ( max - min ) / 2 * 100% ] 250000.00%
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=sleeper_surprise
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 shadowform,if=!buff.shadowform.up
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=draenic_intellect
6 0.00 mind_spike
Default action list Executed every time the actor is available.
# count action,conditions
7 0.00 shadowform,if=!buff.shadowform.up
8 1.00 potion,name=draenic_intellect,if=buff.bloodlust.react|target.time_to_die<=40
9 0.00 power_infusion,if=talent.power_infusion.enabled
A 0.00 blood_fury
B 0.00 berserking
C 0.00 arcane_torrent
D 0.00 call_action_list,name=pvp_dispersion,if=set_bonus.pvp_2pc
E 0.00 call_action_list,name=decision
actions.cop_dotweave
# count action,conditions
. 7.45 devouring_plague,if=target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&shadow_orb=5&cooldown_react
. 0.00 devouring_plague,if=(buff.mental_instinct.remains<gcd&buff.mental_instinct.remains)
. 6.89 devouring_plague,if=(target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&!buff.shadow_word_insanity.remains&cooldown.mind_blast.remains>0.4*gcd)
. 0.00 mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb<=2,cycle_targets=1
. 45.93 mind_blast,if=shadow_orb<=4&cooldown_react
. 1.95 shadowfiend,if=!talent.mindbender.enabled&!buff.shadow_word_insanity.remains
. 0.00 mindbender,if=talent.mindbender.enabled&!buff.shadow_word_insanity.remains
. 0.00 shadow_word_pain,if=shadow_orb=4&set_bonus.tier17_2pc&!target.dot.shadow_word_pain.ticking&!target.dot.devouring_plague.ticking&cooldown.mind_blast.remains<1.2*gcd&cooldown.mind_blast.remains>0.2*gcd
. 7.49 shadow_word_pain,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.shadow_word_pain.ticking
. 7.46 vampiric_touch,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.vampiric_touch.ticking
. 14.51 insanity,if=buff.shadow_word_insanity.remains,chain=1,interrupt_if=cooldown.mind_blast.remains<=0.1
. 0.12 shadow_word_pain,if=shadow_orb>=2&target.dot.shadow_word_pain.remains>=6&cooldown.mind_blast.remains>0.5*gcd&target.dot.vampiric_touch.remains&buff.bloodlust.up&!set_bonus.tier17_2pc
. 0.00 vampiric_touch,if=shadow_orb>=2&target.dot.vampiric_touch.remains>=5&cooldown.mind_blast.remains>0.5*gcd&buff.bloodlust.up&!set_bonus.tier17_2pc
. 5.48 halo,if=cooldown.mind_blast.remains>0.5*gcd&talent.halo.enabled&target.distance<=30&target.distance>=17
. 0.00 divine_star,if=cooldown.mind_blast.remains>0.5&gcd&talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
. 0.00 cascade,if=cooldown.mind_blast.remains>0.5*gcd&talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
. 0.00 shadow_word_pain,if=primary_target=0&(!ticking|remains<=18*0.3),cycle_targets=1,max_cycle_targets=5
. 0.00 vampiric_touch,if=primary_target=0&(!ticking|remains<=15*0.3),cycle_targets=1,max_cycle_targets=5
. 15.94 mind_spike,if=buff.shadow_word_insanity.remains<=gcd&buff.bloodlust.up&!target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains
. 0.12 mind_spike,if=((target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains)|(!target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains))&shadow_orb<=2&cooldown.mind_blast.remains>0.5*gcd
. 0.00 mind_flay,if=set_bonus.tier17_2pc&target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains&cooldown.mind_blast.remains>0.9*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
. 45.53 mind_spike
. 0.00 shadow_word_death,moving=1
. 0.00 halo,if=talent.halo.enabled&target.distance<=30,moving=1
. 0.00 divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
. 0.00 cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
. 0.00 shadow_word_pain,moving=1
actions.cop_mfi
# count action,conditions
. 4.89 devouring_plague,if=shadow_orb=5
. 0.00 mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0,cycle_targets=1
. 10.89 mind_blast,if=active_enemies<=5&cooldown_react
. 11.39 shadow_word_death,if=target.health.pct<20,cycle_targets=1
. 2.51 devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<gcd*1.0|target.health.pct<20&cooldown.shadow_word_death.remains<gcd*1.0)
. 0.00 mindbender,if=talent.mindbender.enabled
. 0.07 shadowfiend,if=!talent.mindbender.enabled
. 0.00 shadow_word_pain,if=remains<(18*0.3)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
. 0.00 vampiric_touch,if=remains<(15*0.3+cast_time)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
. 1.33 insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
. 4.53 insanity,if=active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
. 1.21 halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
. 0.00 cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
. 0.00 divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
. 0.00 mind_sear,if=active_enemies>=6,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
. 4.59 mind_spike
. 0.00 shadow_word_death,moving=1
. 0.00 mind_blast,if=buff.shadowy_insight.react&cooldown_react,moving=1
. 0.00 halo,if=talent.halo.enabled&target.distance<=30,moving=1
. 0.00 divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
. 0.00 cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
. 0.00 shadow_word_pain,if=primary_target=0,moving=1,cycle_targets=1

Sample Sequence

01356.........................................................................................................................................................................8............................

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb
Pre food Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb
Pre shadowform Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb draenic_intellect_potion
0:00.000 mind_spike Fluffy_Pillow 159809.0/160000: 100% mana | 0.0/5: 0% shadow_orb draenic_intellect_potion
0:00.000 mind_blast Fluffy_Pillow 159809.0/160000: 100% mana | 0.0/5: 0% shadow_orb draenic_intellect_potion
0:01.356 shadowfiend Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:02.400 halo Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:03.443 mind_spike Fluffy_Pillow 159067.5/160000: 99% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:04.487 mind_spike Fluffy_Pillow 159544.7/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:05.530 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, draenic_intellect_potion
0:06.575 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:07.620 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:08.664 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:09.709 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, draenic_intellect_potion
0:10.752 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:11.797 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:12.840 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, shadowy_insight, draenic_intellect_potion
0:13.884 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, draenic_intellect_potion
0:14.928 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:15.973 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:17.015 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:18.060 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, draenic_intellect_potion
0:19.105 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb bloodlust, draenic_intellect_potion
0:20.150 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb bloodlust
0:21.194 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb bloodlust
0:22.238 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, shadow_word_insanity
0:23.282 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, shadow_word_insanity
0:26.671 mind_blast Fluffy_Pillow 158969.0/160000: 99% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:27.717 devouring_plague Fluffy_Pillow 159238.4/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, glyph_of_mind_flay
0:28.762 insanity Fluffy_Pillow 159907.2/160000: 100% mana | 1.0/5: 20% shadow_orb bloodlust, shadow_word_insanity, glyph_of_mind_flay
0:31.584 mind_blast Fluffy_Pillow 158513.3/160000: 99% mana | 1.0/5: 20% shadow_orb bloodlust, shadow_word_insanity, glyph_of_mind_flay
0:32.628 mind_spike Fluffy_Pillow 158781.4/160000: 99% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:33.674 mind_spike Fluffy_Pillow 159259.9/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:34.717 mind_spike Fluffy_Pillow 159736.4/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:35.763 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb bloodlust, glyph_of_mind_flay
0:36.808 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:37.852 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:38.898 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:39.941 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb bloodlust, glyph_of_mind_flay
0:40.986 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb bloodlust, glyph_of_mind_flay
0:42.031 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:43.387 halo Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:44.744 mind_blast Fluffy_Pillow 159268.5/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:46.099 shadow_word_pain Fluffy_Pillow 159735.7/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
0:47.456 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
0:48.810 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
0:50.167 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
0:51.523 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
0:55.866 mind_blast Fluffy_Pillow 159579.5/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
0:57.222 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
0:58.580 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:02.151 mind_blast Fluffy_Pillow 159085.4/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:03.508 mind_spike Fluffy_Pillow 159553.9/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:04.865 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:06.223 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:07.579 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:08.936 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:10.292 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:11.649 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:13.004 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:14.362 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:15.720 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:17.077 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:18.434 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:19.791 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:21.145 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:22.500 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:23.857 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:25.213 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:28.894 mind_blast Fluffy_Pillow 159155.8/160000: 99% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:30.250 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:31.608 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:35.161 mind_blast Fluffy_Pillow 159073.9/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:36.515 halo Fluffy_Pillow 159540.5/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:37.872 mind_spike Fluffy_Pillow 158809.0/160000: 99% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:39.230 mind_spike Fluffy_Pillow 159487.1/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:40.586 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
1:41.942 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:43.298 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:44.655 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:46.012 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
1:47.368 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:48.722 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:50.080 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadowy_insight, glyph_of_mind_flay
1:51.437 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
1:52.793 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:54.151 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
1:55.507 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb shadowy_insight, glyph_of_mind_flay
1:56.865 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
1:58.223 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:02.592 mind_blast Fluffy_Pillow 159596.2/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:03.948 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:05.303 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:08.750 mind_blast Fluffy_Pillow 159006.1/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:10.108 mind_spike Fluffy_Pillow 159475.2/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:11.463 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:12.820 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadowy_insight, glyph_of_mind_flay
2:14.176 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:15.532 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:16.887 halo Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:18.246 mind_spike Fluffy_Pillow 159269.8/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:19.603 mind_blast Fluffy_Pillow 159947.2/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:20.960 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:22.317 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:23.673 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:25.028 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:26.385 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:27.742 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:29.099 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
2:30.456 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:31.812 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:36.167 mind_blast Fluffy_Pillow 159587.2/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:37.525 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:38.881 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:42.550 mind_blast Fluffy_Pillow 159148.2/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
2:43.908 mind_spike Fluffy_Pillow 159617.3/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:45.265 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:46.622 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:47.979 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
2:49.335 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:50.692 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:52.049 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:53.405 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
2:54.761 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:56.119 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:57.475 halo Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
2:58.831 mind_blast Fluffy_Pillow 159267.8/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:00.187 shadow_word_pain Fluffy_Pillow 159735.7/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:01.543 shadowfiend Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:02.897 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:04.253 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:05.610 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:06.965 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:10.549 mind_blast Fluffy_Pillow 159093.8/160000: 99% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:11.906 devouring_plague Fluffy_Pillow 159962.2/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:13.260 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:16.907 mind_blast Fluffy_Pillow 159134.1/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:18.264 mind_spike Fluffy_Pillow 159602.6/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:19.620 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:20.976 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:22.334 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:23.692 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:25.049 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:26.405 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:27.761 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:29.115 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:30.472 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:31.828 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:33.184 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:34.542 shadow_word_pain Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:35.898 vampiric_touch Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb glyph_of_mind_flay
3:37.256 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb shadowy_insight, glyph_of_mind_flay
3:38.612 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:39.968 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:44.359 mind_blast Fluffy_Pillow 159610.2/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
3:45.715 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
3:47.069 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:50.715 mind_blast Fluffy_Pillow 159133.4/160000: 99% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay
3:52.071 halo Fluffy_Pillow 159601.3/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:53.427 mind_spike Fluffy_Pillow 158869.1/160000: 99% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:54.784 shadow_word_death Fluffy_Pillow 159546.6/160000: 100% mana | 2.0/5: 40% shadow_orb glyph_of_mind_flay
3:56.140 mind_blast Fluffy_Pillow 159614.4/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
3:57.498 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
3:58.852 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:00.207 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:01.804 mind_blast Fluffy_Pillow 159422.1/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:03.160 insanity Fluffy_Pillow 159889.9/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:04.750 devouring_plague Fluffy_Pillow 159307.5/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
4:06.106 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb shadow_word_insanity, glyph_of_mind_flay
4:07.463 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:08.819 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:10.176 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:11.534 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:12.892 potion Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:12.892 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:14.249 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:15.605 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay, draenic_intellect_potion
4:16.961 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay, draenic_intellect_potion
4:18.317 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:19.675 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:21.032 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:22.389 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:23.747 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:25.103 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:26.458 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay, draenic_intellect_potion
4:28.032 shadow_word_death Fluffy_Pillow 159407.4/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, glyph_of_mind_flay, draenic_intellect_potion
4:29.389 mind_blast Fluffy_Pillow 159475.8/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:30.746 shadow_word_death Fluffy_Pillow 159944.3/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:32.103 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 5.0/5: 100% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:33.460 insanity Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:35.140 mind_blast Fluffy_Pillow 159475.2/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:36.496 insanity Fluffy_Pillow 159943.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay, draenic_intellect_potion
4:38.113 devouring_plague Fluffy_Pillow 159377.9/160000: 100% mana | 3.0/5: 60% shadow_orb glyph_of_mind_flay
4:39.467 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/5: 0% shadow_orb shadow_word_insanity, glyph_of_mind_flay
4:40.824 mind_blast Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:42.181 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 2.0/5: 40% shadow_orb shadow_word_insanity, shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:43.538 halo Fluffy_Pillow 160000.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:44.895 mind_spike Fluffy_Pillow 159268.5/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:46.252 mind_blast Fluffy_Pillow 159946.0/160000: 100% mana | 3.0/5: 60% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:47.609 mind_spike Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb shadow_word_death_reset_cooldown, glyph_of_mind_flay
4:48.965 devouring_plague Fluffy_Pillow 160000.0/160000: 100% mana | 4.0/5: 80% shadow_orb glyph_of_mind_flay
4:50.321 shadow_word_death Fluffy_Pillow 160000.0/160000: 100% mana | 1.0/5: 20% shadow_orb shadow_word_insanity, glyph_of_mind_flay

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 880 839 839
Agility 1124 1071 1071
Stamina 4136 3760 3760
Intellect 3911 3462 3350 (2256)
Spirit 782 782 782
Health 248160 225600 0
Mana 160000 160000 0
Shadow Orb 5 5 0
Spell Power 5354 4418 956
Crit 21.77% 16.77% 1295
Haste 10.92% 5.64% 459
Multistrike 11.33% 6.33% 418
Damage / Heal Versatility 6.42% 3.42% 444
ManaReg per Second 640 640 0
Mastery 47.80% 33.03% 573
Armor 1206 603 603
Run Speed 0 0 82

Talents

Level
15 Desperate Prayer Spectral Guise Angelic Bulwark
30 Body and Soul Angelic Feather Phantasm
45 Surge of Darkness (Shadow Priest) Mindbender Insanity (Shadow Priest)
60 Void Tendrils Psychic Scream Dominate Mind
75 Twist of Fate Power Infusion Shadowy Insight (Shadow Priest)
90 Cascade (Shadow Priest) Divine Star (Shadow Priest) Halo (Shadow Priest)
100 Clarity of Power (Shadow Priest) Void Entropy (Shadow Priest) Auspicious Spirits (Shadow Priest)

Profile

priest="Swæty"
origin="http://eu.battle.net/wow/en/character/forscherliga/Swæty/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/13/55890701-avatar.jpg"
level=100
race=night_elf
role=spell
position=back
professions=enchanting=682/mining=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Xb!2022220
glyphs=fade/mind_blast/mind_flay/dark_archangel/heavens/shadow_ravens
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=sleeper_surprise
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/shadowform,if=!buff.shadowform.up
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/mind_spike

# Executed every time the actor is available.

actions=shadowform,if=!buff.shadowform.up
actions+=/potion,name=draenic_intellect,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/call_action_list,name=pvp_dispersion,if=set_bonus.pvp_2pc
actions+=/call_action_list,name=decision

actions.decision=call_action_list,name=cop_dotweave,if=talent.clarity_of_power.enabled&talent.insanity.enabled&target.health.pct>20&active_enemies<=5
actions.decision+=/call_action_list,name=cop_mfi,if=talent.clarity_of_power.enabled&talent.insanity.enabled&target.health.pct<=20
actions.decision+=/call_action_list,name=cop,if=talent.clarity_of_power.enabled
actions.decision+=/call_action_list,name=vent,if=talent.void_entropy.enabled
actions.decision+=/call_action_list,name=main

actions.pvp_dispersion=call_action_list,name=decision,if=cooldown.dispersion.remains>0
actions.pvp_dispersion+=/dispersion,interrupt=1
actions.pvp_dispersion+=/call_action_list,name=decision

actions.main=mindbender,if=talent.mindbender.enabled
actions.main+=/shadowfiend,if=!talent.mindbender.enabled
actions.main+=/shadow_word_death,if=target.health.pct<20&shadow_orb<=4,cycle_targets=1
actions.main+=/mind_blast,if=glyph.mind_harvest.enabled&shadow_orb<=2&active_enemies<=5&cooldown_react
actions.main+=/devouring_plague,if=shadow_orb=5&talent.surge_of_darkness.enabled,cycle_targets=1
actions.main+=/devouring_plague,if=shadow_orb=5
actions.main+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)&!target.dot.devouring_plague_tick.ticking&talent.surge_of_darkness.enabled,cycle_targets=1
actions.main+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<1.5|target.health.pct<20&cooldown.shadow_word_death.remains<1.5)
actions.main+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0,cycle_targets=1
actions.main+=/mind_blast,if=active_enemies<=5&cooldown_react
actions.main+=/insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/insanity,chain=1,if=active_enemies<=2,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/halo,if=talent.halo.enabled&target.distance<=30&active_enemies>2
actions.main+=/cascade,if=talent.cascade.enabled&active_enemies>2&target.distance<=40
actions.main+=/divine_star,if=talent.divine_star.enabled&active_enemies>4&target.distance<=24
actions.main+=/shadow_word_pain,if=talent.auspicious_spirits.enabled&remains<(18*0.3)&miss_react,cycle_targets=1
actions.main+=/shadow_word_pain,if=!talent.auspicious_spirits.enabled&remains<(18*0.3)&miss_react&active_enemies<=5,cycle_targets=1,max_cycle_targets=5
actions.main+=/vampiric_touch,if=remains<(15*0.3+cast_time)&miss_react&active_enemies<=5,cycle_targets=1,max_cycle_targets=5
actions.main+=/devouring_plague,if=!talent.void_entropy.enabled&shadow_orb>=3&ticks_remain<=1
actions.main+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=3
actions.main+=/halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
actions.main+=/cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.main+=/divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.main+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains&cooldown.shadow_word_death.remains<0.5&active_enemies<=1
actions.main+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5&cooldown.mind_blast.remains&active_enemies<=1
actions.main+=/mind_spike,if=buff.surge_of_darkness.react&active_enemies<=5
actions.main+=/divine_star,if=talent.divine_star.enabled&target.distance<=28&active_enemies>1
actions.main+=/mind_sear,chain=1,if=active_enemies>=4,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/shadow_word_pain,if=shadow_orb>=2&ticks_remain<=3&talent.insanity.enabled
actions.main+=/vampiric_touch,if=shadow_orb>=2&ticks_remain<=3.5&talent.insanity.enabled
actions.main+=/mind_flay,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1|shadow_orb=5)
actions.main+=/mind_blast,moving=1,if=buff.shadowy_insight.react&cooldown_react
actions.main+=/divine_star,moving=1,if=talent.divine_star.enabled&target.distance<=28
actions.main+=/cascade,moving=1,if=talent.cascade.enabled&target.distance<=40
actions.main+=/shadow_word_death,moving=1
actions.main+=/shadow_word_pain,moving=1,cycle_targets=1

actions.vent=mindbender,if=talent.mindbender.enabled&cooldown.mind_blast.remains>=gcd
actions.vent+=/shadowfiend,if=!talent.mindbender.enabled&cooldown.mind_blast.remains>=gcd
actions.vent+=/void_entropy,if=shadow_orb=3&!ticking&target.time_to_die>60&active_enemies=1
actions.vent+=/void_entropy,if=!dot.void_entropy.ticking&shadow_orb=5&active_enemies>=1&target.time_to_die>60,cycle_targets=1,max_cycle_targets=(60%(cooldown.mind_blast.duration*3*spell_haste))
actions.vent+=/devouring_plague,if=dot.void_entropy.ticking&dot.void_entropy.remains<=gcd*2&cooldown_react,cycle_targets=1
actions.vent+=/devouring_plague,if=shadow_orb=5&dot.void_entropy.remains<10,cycle_targets=1
actions.vent+=/devouring_plague,if=shadow_orb=5&dot.void_entropy.remains<20,cycle_targets=1
actions.vent+=/devouring_plague,if=shadow_orb=5&dot.void_entropy.remains,cycle_targets=1
actions.vent+=/halo,if=talent.halo.enabled&target.distance<=30&active_enemies>=4
actions.vent+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb<=2,cycle_targets=1
actions.vent+=/devouring_plague,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb>=3,cycle_targets=1
actions.vent+=/mind_blast,if=active_enemies<=10&cooldown_react&shadow_orb<=4
actions.vent+=/shadow_word_death,if=target.health.pct<20&cooldown_react&shadow_orb<=4,cycle_targets=1
actions.vent+=/shadow_word_pain,if=shadow_orb=4&remains<(18*0.50)&set_bonus.tier17_2pc&cooldown.mind_blast.remains<1.2*gcd&cooldown.mind_blast.remains>0.2*gcd
actions.vent+=/insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=3&cooldown.mind_blast.remains>0.5*gcd,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.vent+=/insanity,chain=1,if=active_enemies<=3&cooldown.mind_blast.remains>0.5*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.vent+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.react=3
actions.vent+=/shadow_word_pain,if=remains<(18*0.35)&miss_react,cycle_targets=1,max_cycle_targets=5
actions.vent+=/vampiric_touch,if=remains<(15*0.35)&miss_react,cycle_targets=1,max_cycle_targets=5
actions.vent+=/halo,if=talent.halo.enabled&target.distance<=30&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/cascade,if=talent.cascade.enabled&target.distance<=40&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/divine_star,if=talent.divine_star.enabled&active_enemies>4&target.distance<=24&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/mind_spike,if=active_enemies<=5&buff.surge_of_darkness.up&cooldown_react&cooldown.mind_blast.remains>0.5*gcd
actions.vent+=/mind_sear,chain=1,if=active_enemies>=3&cooldown.mind_blast.remains>0.5*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.vent+=/mind_flay,if=cooldown.mind_blast.remains>0.5*gcd,interrupt=1,chain=1
actions.vent+=/shadow_word_death,moving=1
actions.vent+=/mind_blast,moving=1,if=buff.shadowy_insight.react&cooldown_react
actions.vent+=/divine_star,moving=1,if=talent.divine_star.enabled&target.distance<=28
actions.vent+=/cascade,moving=1,if=talent.cascade.enabled&target.distance<=40
actions.vent+=/shadow_word_death,moving=1
actions.vent+=/shadow_word_pain,moving=1,cycle_targets=1

actions.cop_dotweave=devouring_plague,if=target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&shadow_orb=5&cooldown_react
actions.cop_dotweave+=/devouring_plague,if=(buff.mental_instinct.remains<gcd&buff.mental_instinct.remains)
actions.cop_dotweave+=/devouring_plague,if=(target.dot.vampiric_touch.ticking&target.dot.shadow_word_pain.ticking&!buff.shadow_word_insanity.remains&cooldown.mind_blast.remains>0.4*gcd)
actions.cop_dotweave+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0&shadow_orb<=2,cycle_targets=1
actions.cop_dotweave+=/mind_blast,if=shadow_orb<=4&cooldown_react
actions.cop_dotweave+=/shadowfiend,if=!talent.mindbender.enabled&!buff.shadow_word_insanity.remains
actions.cop_dotweave+=/mindbender,if=talent.mindbender.enabled&!buff.shadow_word_insanity.remains
actions.cop_dotweave+=/shadow_word_pain,if=shadow_orb=4&set_bonus.tier17_2pc&!target.dot.shadow_word_pain.ticking&!target.dot.devouring_plague.ticking&cooldown.mind_blast.remains<1.2*gcd&cooldown.mind_blast.remains>0.2*gcd
actions.cop_dotweave+=/shadow_word_pain,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.shadow_word_pain.ticking
actions.cop_dotweave+=/vampiric_touch,if=shadow_orb=5&!target.dot.devouring_plague.ticking&!target.dot.vampiric_touch.ticking
actions.cop_dotweave+=/insanity,if=buff.shadow_word_insanity.remains,chain=1,interrupt_if=cooldown.mind_blast.remains<=0.1
actions.cop_dotweave+=/shadow_word_pain,if=shadow_orb>=2&target.dot.shadow_word_pain.remains>=6&cooldown.mind_blast.remains>0.5*gcd&target.dot.vampiric_touch.remains&buff.bloodlust.up&!set_bonus.tier17_2pc
actions.cop_dotweave+=/vampiric_touch,if=shadow_orb>=2&target.dot.vampiric_touch.remains>=5&cooldown.mind_blast.remains>0.5*gcd&buff.bloodlust.up&!set_bonus.tier17_2pc
actions.cop_dotweave+=/halo,if=cooldown.mind_blast.remains>0.5*gcd&talent.halo.enabled&target.distance<=30&target.distance>=17
actions.cop_dotweave+=/divine_star,if=cooldown.mind_blast.remains>0.5&gcd&talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.cop_dotweave+=/cascade,if=cooldown.mind_blast.remains>0.5*gcd&talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.cop_dotweave+=/shadow_word_pain,if=primary_target=0&(!ticking|remains<=18*0.3),cycle_targets=1,max_cycle_targets=5
actions.cop_dotweave+=/vampiric_touch,if=primary_target=0&(!ticking|remains<=15*0.3),cycle_targets=1,max_cycle_targets=5
actions.cop_dotweave+=/mind_spike,if=buff.shadow_word_insanity.remains<=gcd&buff.bloodlust.up&!target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains
actions.cop_dotweave+=/mind_spike,if=((target.dot.shadow_word_pain.remains&!target.dot.vampiric_touch.remains)|(!target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains))&shadow_orb<=2&cooldown.mind_blast.remains>0.5*gcd
actions.cop_dotweave+=/mind_flay,if=set_bonus.tier17_2pc&target.dot.shadow_word_pain.remains&target.dot.vampiric_touch.remains&cooldown.mind_blast.remains>0.9*gcd,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop_dotweave+=/mind_spike
actions.cop_dotweave+=/shadow_word_death,moving=1
actions.cop_dotweave+=/halo,if=talent.halo.enabled&target.distance<=30,moving=1
actions.cop_dotweave+=/divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
actions.cop_dotweave+=/cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
actions.cop_dotweave+=/shadow_word_pain,moving=1

actions.cop_mfi=devouring_plague,if=shadow_orb=5
actions.cop_mfi+=/mind_blast,if=glyph.mind_harvest.enabled&mind_harvest=0,cycle_targets=1
actions.cop_mfi+=/mind_blast,if=active_enemies<=5&cooldown_react
actions.cop_mfi+=/shadow_word_death,if=target.health.pct<20,cycle_targets=1
actions.cop_mfi+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<gcd*1.0|target.health.pct<20&cooldown.shadow_word_death.remains<gcd*1.0)
actions.cop_mfi+=/mindbender,if=talent.mindbender.enabled
actions.cop_mfi+=/shadowfiend,if=!talent.mindbender.enabled
actions.cop_mfi+=/shadow_word_pain,if=remains<(18*0.3)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop_mfi+=/vampiric_touch,if=remains<(15*0.3+cast_time)&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop_mfi+=/insanity,if=buff.shadow_word_insanity.remains<0.5*gcd&active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
actions.cop_mfi+=/insanity,if=active_enemies<=2,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|(cooldown.shadow_word_death.remains<=0.1*target.health.pct<20))
actions.cop_mfi+=/halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
actions.cop_mfi+=/cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.cop_mfi+=/divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.cop_mfi+=/mind_sear,if=active_enemies>=6,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop_mfi+=/mind_spike
actions.cop_mfi+=/shadow_word_death,moving=1
actions.cop_mfi+=/mind_blast,if=buff.shadowy_insight.react&cooldown_react,moving=1
actions.cop_mfi+=/halo,if=talent.halo.enabled&target.distance<=30,moving=1
actions.cop_mfi+=/divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
actions.cop_mfi+=/cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
actions.cop_mfi+=/shadow_word_pain,if=primary_target=0,moving=1,cycle_targets=1

actions.cop=devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<=gcd*1.0|(cooldown.shadow_word_death.remains<=gcd*1.0&target.health.pct<20))&primary_target=0,cycle_targets=1
actions.cop+=/devouring_plague,if=shadow_orb>=3&(cooldown.mind_blast.remains<=gcd*1.0|(cooldown.shadow_word_death.remains<=gcd*1.0&target.health.pct<20))
actions.cop+=/mind_blast,if=mind_harvest=0,cycle_targets=1
actions.cop+=/mind_blast,if=active_enemies<=5&cooldown_react
actions.cop+=/shadow_word_death,if=target.health.pct<20,cycle_targets=1
actions.cop+=/mindbender,if=talent.mindbender.enabled
actions.cop+=/shadowfiend,if=!talent.mindbender.enabled
actions.cop+=/halo,if=talent.halo.enabled&target.distance<=30&target.distance>=17
actions.cop+=/cascade,if=talent.cascade.enabled&((active_enemies>1|target.distance>=28)&target.distance<=40&target.distance>=11)
actions.cop+=/divine_star,if=talent.divine_star.enabled&(active_enemies>1|target.distance<=24)
actions.cop+=/shadow_word_pain,if=miss_react&!ticking&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop+=/vampiric_touch,if=remains<cast_time&miss_react&active_enemies<=5&primary_target=0,cycle_targets=1,max_cycle_targets=5
actions.cop+=/mind_sear,if=active_enemies>=5,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop+=/mind_spike,if=active_enemies<=4&buff.surge_of_darkness.react
actions.cop+=/mind_sear,if=active_enemies>=3,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop+=/mind_flay,if=target.dot.devouring_plague_tick.ticks_remain>1&active_enemies=1,chain=1,interrupt_if=(cooldown.mind_blast.remains<=0.1|cooldown.shadow_word_death.remains<=0.1)
actions.cop+=/mind_spike
actions.cop+=/shadow_word_death,moving=1
actions.cop+=/mind_blast,if=buff.shadowy_insight.react&cooldown_react,moving=1
actions.cop+=/halo,moving=1,if=talent.halo.enabled&target.distance<=30
actions.cop+=/divine_star,if=talent.divine_star.enabled&target.distance<=28,moving=1
actions.cop+=/cascade,if=talent.cascade.enabled&target.distance<=40,moving=1
actions.cop+=/shadow_word_pain,if=primary_target=0,moving=1,cycle_targets=1

head=crown_of_power,id=118942
neck=braided_magnaron_plait,id=120084,enchant=40crit
shoulders=felflame_spaulders,id=109948,bonus_id=523/524,gems=35mastery
back=kyusys_tarflame_doomcloak,id=119346,bonus_id=560,enchant=100crit
chest=robes_of_volatile_ice,id=114500,bonus_id=81/563,gems=35crit
shirt=paper_shirt,id=98087
tabard=argent_crusaders_tabard,id=46874
wrists=bracers_of_volatile_ice,id=114493,bonus_id=220/560
hands=sterilized_handwraps,id=115998
waist=girdle_of_the_infected_mind,id=113656
legs=lightbinder_leggings,id=109807,bonus_id=523/524,gems=35mastery
feet=sandals_of_volatile_ice,id=114501,bonus_id=142/563,gems=35crit
finger1=timeless_solium_band_of_the_archmage,id=118296,enchant=30crit
finger2=darkflame_loop,id=109766,bonus_id=524,enchant=30crit
trinket1=grandiose_power,id=114550,bonus_id=42
trinket2=crushtos_runic_alarm,id=110000,bonus_id=524
main_hand=hoof_of_yalnu,id=119181,bonus_id=524,enchant=mark_of_the_shattered_hand
off_hand=bileslingers_censer,id=113592,bonus_id=566

# Gear Summary
# gear_stamina=2870
# gear_intellect=2256
# gear_spell_power=956
# gear_crit_rating=1295
# gear_haste_rating=437
# gear_mastery_rating=573
# gear_armor=603
# gear_multistrike_rating=418
# gear_versatility_rating=444
# gear_speed_rating=82

Ralana

Ralana : 20942 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
20942.4 20942.4 7.6 / 0.036% 2371.4 / 11.3% 714.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
29.3 29.3 Energy 31.38% 43.8 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Ralana/advanced
Talents
  • 15: Shadow Focus
  • 30: Combat Readiness
  • 45: Elusiveness
  • 60: Shadowstep
  • 75: Prey on the Weak
  • 90: Anticipation
  • 100: Venom Rush
  • Talent Calculator
Glyphs
  • Glyph of Energy
  • Glyph of Feint
  • Glyph of Disappearance
  • Glyph of Poisons
  • Glyph of Safe Fall
  • Glyph of Decoy
Professions
  • engineering: 659
  • jewelcrafting: 659

Charts

http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Ralana+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:28809|19666|18511|9767|7322|4581|2250&chds=0,57617&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++28809++eviscerate,C79C6E,0,0,15|t++19666++killing_spree,C79C6E,1,0,15|t++18511++ambush,C79C6E,2,0,15|t++9767++sinister_strike,C79C6E,3,0,15|t++7322++revealing_strike,C79C6E,4,0,15|t++4581++auto_attack_mh,C79C6E,5,0,15|t++2250++auto_attack_oh,C79C6E,6,0,15& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ralana+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:22,19,16,14,11,10,4,2,2,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E&chl=auto_attack_mh|sinister_strike|eviscerate|main_gauche|auto_attack_oh|instant_poison|killing_spree_mh|ambush|killing_spree_oh|revealing_strike&
http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Ralana+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:begjnqty2668765445665431ywurolkjhgedbaYXWVWWXXYZabbcefghijjkkllkkjihgedcbaZYYYYYZabcdfhjlnprtvxyz1122210zywusqnljhfdcaYXWVVUUUUVVWWXYYZabccdddeeeeedddccbbaZZYYYYYYYYZZabcdefghijklmmnnnnnnmmlkjihfedcbaZYYXWWWWWWXXYYZZaabcddeffghhhiiihhhggfeedcbaaZYYXXXXXXXYYZabbcdfghijkllmnnnoonnnmmlkjihgfedcbbaZZZZYYYYZZZZZaaaaabbbbbbbaaaaaZZZZZZZZZZZaaabbccdeefgghhiijjkkkjjihfecaYWUSRP&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.553698,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=20942|max=37823&chxp=1,1,55,100 http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Ralana+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,1,0,4,6,18,19,32,68,112,139,251,314,445,605,740,958,1107,1244,1394,1446,1601,1611,1563,1503,1464,1321,1185,1074,923,760,668,587,495,360,270,214,132,120,83,57,34,21,19,8,14,2,5,2&chds=0,1611&chbh=5&chxt=x&chxl=0:|min=18564|avg=20942|max=23413&chxp=0,1,49,100& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Ralana+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:41.3,11.3,6.2,4.0,3.1,2.4,0.4,31.4&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=sinister_strike 124.3s|eviscerate 34.0s|killing_spree 18.6s|revealing_strike 12.2s|slice_and_dice 9.5s|ambush 7.1s|preparation 1.2s|waiting 94.4s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Ralana 20942
ambush 438 2.1% 7.1 48.84sec 18593 18511 Direct 7.1 14548 29086 17761 22.1% 1.1 4363 8690 21.5%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 7.07 0.00 0.00 1.0045 0.0000 131523.64 202131.07 34.93 18511.42 18511.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.24 21.54% 8689.75 6544 12077 1848.18 0 12077 2081 3198 7.43
multistrike 0.87 78.46% 4363.07 3272 6039 2565.65 0 6039 3807 5851 20.52
hit 5.51 77.90% 14547.68 10906 20128 14574.65 0 20128 80167 123204 34.93
crit 1.56 22.10% 29085.93 21812 40257 23977.05 0 40257 45469 69878 28.77
 
DPS Timeline Chart
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage to the target (damage increased 40% if a dagger is equipped){$?s138106=false}[ and causes you to appear behind the target][]. Awards {$s3=2} combo $lpoint:points;.{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.11
 
auto_attack_mh 4516 21.6% 219.3 1.37sec 6188 4581 Direct 219.3 4853 9706 5912 21.8% 34.0 1456 2912 21.8%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 219.28 219.28 0.00 0.00 1.3508 0.0000 1356820.78 2085219.30 34.93 4580.54 4580.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.44 21.84% 2911.87 2251 4164 2910.67 0 4164 21655 33281 34.90
multistrike 26.61 78.16% 1455.83 1125 2082 1456.81 1247 1701 38743 59543 34.93
hit 171.40 78.17% 4852.56 3751 6941 4855.66 4696 5093 831743 1278258 34.93
crit 47.88 21.83% 9705.58 7502 13882 9711.72 8708 10851 464679 714138 34.93
 
DPS Timeline Chart
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2217 10.6% 215.5 1.39sec 3090 2250 Direct 215.5 2423 4845 2952 21.9% 33.5 727 1453 21.9%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 215.55 215.55 0.00 0.00 1.3734 0.0000 666037.30 1023594.17 34.93 2249.86 2249.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.33 21.89% 1453.15 1125 2082 1452.89 0 2082 10659 16381 34.90
multistrike 26.18 78.11% 726.88 563 1041 727.38 620 877 19029 29244 34.93
hit 168.44 78.14% 2422.85 1876 3470 2424.36 2332 2517 408096 627179 34.93
crit 47.11 21.86% 4845.08 3751 6941 4848.00 4411 5422 228254 350791 34.93
 
DPS Timeline Chart
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
eviscerate 3260 15.6% 36.4 7.90sec 26946 28809 Direct 36.4 21126 42229 25748 21.9% 5.6 6339 12684 21.9%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.35 36.35 0.00 0.00 0.9354 0.0000 979522.56 1505371.51 34.93 28808.64 28808.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.23 21.89% 12683.73 8693 16677 9020.57 0 16677 15648 24049 24.82
multistrike 4.40 78.11% 6339.32 4347 8339 6267.64 0 8339 27907 42889 34.50
hit 28.39 78.09% 21125.52 14489 27795 21148.92 19410 23173 599713 921664 34.93
crit 7.96 21.91% 42228.97 28977 55591 42264.65 0 55591 336254 516769 34.93
 
DPS Timeline Chart
 

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point: 1 point : ${($AP*0.577)*$<mult>} damage 2 points: ${($AP*0.577)*$<mult>*2} damage 3 points: ${($AP*0.577)*$<mult>*3} damage 4 points: ${($AP*0.577)*$<mult>*4} damage 5 points: ${($AP*0.577)*$<mult>*5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.507760
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
instant_poison 2021 9.6% 210.9 1.45sec 2878 0 Direct 210.9 2257 4514 2750 21.8% 32.8 677 1354 21.8%  

Stats details: instant_poison

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 210.88 210.88 0.00 0.00 0.0000 0.0000 606929.37 606929.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.16 21.84% 1353.81 1030 1975 1353.11 0 1975 9693 9693 0.00
multistrike 25.62 78.16% 676.91 515 988 677.42 571 817 17341 17341 0.00
hit 164.81 78.15% 2256.85 1716 3292 2258.57 2125 2421 371943 371943 0.00
crit 46.07 21.85% 4513.85 3432 6584 4517.28 4031 5282 207952 207952 0.00
 
DPS Timeline Chart
 

Action details: instant_poison

Static Values
  • id:157607
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:157607
  • name:Instant Poison
  • school:nature
  • tooltip:
  • description:{$@spelldesc157584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of instantly poisoning the enemy for {$157607s1=0 to 2} Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.264000
  • spell_power_mod.direct:0.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
killing_spree 0 (1219) 0.0% (5.8%) 5.7 56.89sec 63612 19666

Stats details: killing_spree

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.75 5.75 40.06 40.06 3.2348 0.4282 0.00 0.00 0.00 19665.77 19665.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.3 78.13% 0.00 0 0 0.00 0 0 0 0 0.00
crit 8.8 21.87% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time_to_die>=44
Spelldata
  • id:51690
  • name:Killing Spree
  • school:physical
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
    killing_spree_mh 813 3.9% 40.1 6.99sec 6086 0 Periodic 40.1 4659 9322 5678 21.9% 6.2 2148 4297 21.8% 0.0%

Stats details: killing_spree_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.06 0.00 0.00 40.06 0.0000 0.0000 243760.09 365851.91 33.37 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.4 21.77% 4297.34 3236 5973 3186.43 0 5973 5841 5841 0.00
multistrike 4.9 78.23% 2147.96 1618 2986 2132.61 0 2986 10493 10493 0.00
hit 31.3 78.15% 4658.78 3510 6477 4662.11 3929 5469 145830 224118 34.93
crit 8.8 21.85% 9321.67 7019 12955 9329.14 0 12955 81596 125400 34.93
 
DPS Timeline Chart
 

Action details: killing_spree_mh

Static Values
  • id:57841
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57841
  • name:Killing Spree
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    killing_spree_oh 407 1.9% 40.1 6.99sec 3044 0 Periodic 40.1 2330 4659 2840 21.9% 6.2 1074 2145 21.8% 0.0%

Stats details: killing_spree_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.06 0.00 0.00 40.06 0.0000 0.0000 121924.95 182999.64 33.37 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.4 21.84% 2145.46 1618 2986 1592.40 0 2986 2924 2924 0.00
multistrike 4.9 78.16% 1073.66 809 1493 1065.29 0 1493 5235 5235 0.00
hit 31.3 78.08% 2329.63 1755 3239 2331.31 1949 2740 72861 111977 34.93
crit 8.8 21.92% 4659.16 3510 6477 4663.11 3510 6477 40905 62865 34.93
 
DPS Timeline Chart
 

Action details: killing_spree_oh

Static Values
  • id:57842
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57842
  • name:Killing Spree Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
main_gauche 2935 14.0% 211.6 1.49sec 4165 0 Direct 211.6 3266 6533 3980 21.9% 32.9 980 1961 21.9%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 211.58 211.58 0.00 0.00 0.0000 0.0000 881300.28 1354419.38 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.20 21.89% 1960.76 1474 2720 1960.29 0 2720 14110 21685 34.89
multistrike 25.68 78.11% 979.89 737 1360 980.44 833 1149 25160 38667 34.93
hit 165.34 78.14% 3265.72 2457 4534 3267.70 3053 3476 539954 829824 34.93
crit 46.24 21.86% 6532.61 4913 9068 6536.36 5780 7284 302076 464244 34.93
 
DPS Timeline Chart
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:A vicious attack that deals $86392sw2 Physical damage with your off-hand.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.40
 
revealing_strike 296 1.4% 12.7 24.24sec 7010 7322 Direct 12.7 5500 10998 6698 21.8% 2.0 1652 3294 22.0%  

Stats details: revealing_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.70 12.70 96.48 96.48 0.9574 3.0000 89003.82 1135095.10 92.16 295.10 7322.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.43 22.03% 3293.73 2527 4664 1172.68 0 4664 1430 2198 12.44
multistrike 1.54 77.97% 1651.76 1263 2332 1304.79 0 2332 2537 3899 27.58
hit 9.93 78.22% 5499.76 4212 7773 5502.64 4490 7045 54618 83939 34.93
crit 2.77 21.78% 10998.20 8423 15546 10488.62 0 15546 30419 46749 33.31
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.4 78.10% 0.00 0 0 0.00 0 0 0 779817 100.00
crit 21.1 21.90% 0.00 0 0 0.00 0 0 0 218494 100.00
 
DPS Timeline Chart
 

Action details: revealing_strike

Static Values
  • id:84617
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(combo_points=4&dot.revealing_strike.remains<7.2&(target.time_to_die>dot.revealing_strike.remains+7.2)|(target.time_to_die<dot.revealing_strike.remains+7.2&ticks_remain<2))|!ticking
Spelldata
  • id:84617
  • name:Revealing Strike
  • school:physical
  • tooltip:Reveals weakness, increasing the effectiveness of the Rogue's offensive finishing moves by $w3%, and giving the Rogue's Sinister Strikes a {$h=0}% chance to generate an extra combo point.
  • description:Deals $sw1 Physical damage, increasing the effect of your offensive finishing moves on that target by {$s3=35}%, and giving your Sinister Strike a {$s6=25}% chance to generate an extra combo point. Lasts {$d=24 seconds}. Awards {$s2=1} combo $lpoint:points;.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.20
 
sinister_strike 4040 19.3% 132.0 2.24sec 9192 9767 Direct 132.0 7208 14420 8782 21.8% 20.5 2163 4327 21.8%  

Stats details: sinister_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.04 132.04 0.00 0.00 0.9411 0.0000 1213729.12 1865310.02 34.93 9767.26 9767.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 4.48 21.82% 4326.58 3369 6218 4274.70 0 6218 19378 29781 34.49
multistrike 16.04 78.18% 2162.53 1685 3109 2163.92 1741 2672 34695 53321 34.93
hit 103.22 78.17% 7208.07 5615 10364 7212.85 6882 7576 744015 1143434 34.93
crit 28.82 21.83% 14420.39 11231 20728 14430.37 12429 16773 415641 638775 34.93
 
DPS Timeline Chart
 

Action details: sinister_strike

Static Values
  • id:1752
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.revealing_strike.ticking
Spelldata
  • id:1752
  • name:Sinister Strike
  • school:physical
  • tooltip:
  • description:An instant strike that causes $sw3 Physical damage.{$?s79327=false}[ Awards {$s2=0} combo $lpoint:points;.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.60
 
Simple Action Stats Execute Interval
Ralana
adrenaline_rush 3.9 85.89sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.91 3.91 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 3.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time_to_die>=44
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by ${$m3/-1000}.1 sec.][]
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}. While Adrenaline Rush is active, the global cooldown on most of your Energy consumers is reduced by ${$m3/-1000}.1 sec
 
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
preparation 1.2 313.92sec

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.22 1.22 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 1.22 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.vanish.up&cooldown.vanish.remains>30
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:
  • description:Immediately resets the cooldown on your Sprint, Vanish, and Evasion.
 
slice_and_dice 9.8 32.15sec

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.80 9.80 0.00 0.00 0.9665 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 9.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.marked_for_death.enabled
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
 
vanish 6.1 48.83sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.07 6.07 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 6.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>10&(combo_points<3|(talent.anticipation.enabled&anticipation_charges<3)|(combo_points<4|(talent.anticipation.enabled&anticipation_charges<4)))&((talent.shadow_focus.enabled&buff.adrenaline_rush.down&energy<90&energy>=15)|(talent.subterfuge.enabled&energy>=90)|(!talent.shadow_focus.enabled&!talent.subterfuge.enabled&energy>=60))
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for {$11327d=3 seconds}. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
adrenaline_rush 3.9 0.0 85.9sec 85.9sec 18.98% 19.33% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:18.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by ${$m3/-1000}.1 sec.][]
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}. While Adrenaline Rush is active, the global cooldown on most of your Energy consumers is reduced by ${$m3/-1000}.1 sec
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
anticipation 23.9 55.9 12.3sec 3.6sec 46.54% 46.55% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_anticipation
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • anticipation_1:14.28%
  • anticipation_2:12.07%
  • anticipation_3:10.15%
  • anticipation_4:7.14%
  • anticipation_5:2.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115189
  • name:Anticipation
  • tooltip:Your next offensive finishing move will grant you {$s1=1} combo points on that target.
  • description:{$@spelldesc114015=When one of your attacks generates a combo point while you already have 5 combo points, you gain an Anticipation charge. Performing an offensive finishing move consumes all Anticipation charges and grants you a combo point for each.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
bandits_guile 7.8 82.4 39.9sec 3.3sec 95.01% 95.01% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_bandits_guile
  • max_stacks:12
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bandits_guile_1:5.44%
  • bandits_guile_2:5.58%
  • bandits_guile_3:5.70%
  • bandits_guile_4:5.59%
  • bandits_guile_5:5.53%
  • bandits_guile_6:5.49%
  • bandits_guile_7:5.38%
  • bandits_guile_8:5.41%
  • bandits_guile_9:5.45%
  • bandits_guile_10:5.30%
  • bandits_guile_11:4.98%
  • bandits_guile_12:35.18%

Trigger Attempt Success

  • trigger_pct:68.37%

Spelldata details

  • id:84654
  • name:Bandit's Guile
  • tooltip:
  • description:Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 20.33% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
deep_insight 7.2 0.0 42.2sec 42.2sec 35.18% 10.58% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_deep_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • deep_insight_1:35.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84747
  • name:Deep Insight
  • tooltip:Damage dealt increased by $w1%.
  • description:{$@spelldesc84654=Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
draenic_agility_potion 2.0 0.0 86.1sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
exquisite_proficiency 4.9 0.0 68.2sec 68.2sec 31.43% 31.44% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_exquisite_proficiency
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:mastery_rating
  • amount:581.00

Stack Uptimes

  • exquisite_proficiency_1:31.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:133630
  • name:Exquisite Proficiency
  • tooltip:Increases Mastery rating by {$s1=609}.
  • description:Increases Mastery rating by {$s1=609} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
killing_spree 2.2 0.0 167.7sec 167.7sec 2.20% 2.20% 13.2(13.2)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_killing_spree
  • max_stacks:1
  • duration:3.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • killing_spree_1:2.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51690
  • name:Killing Spree
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows to a visible enemy within 10 yards, attacking 7 times over {$d=3 seconds} for $57841sw3 Physical damage with your main-hand and $57842sw3 Physical damage with your off-hand. While Blade Flurry is active, each Killing Spree attack will teleport to and damage a different nearby enemy target. The Rogue cannot be targeted or disabled while Killing Spree is active.
  • max_stacks:0
  • duration:3.00
  • cooldown:120.00
  • default_chance:0.00%
mark_of_warsong 5.0 2.2 63.3sec 40.9sec 39.01% 39.02% 2.2(12.9)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_mark_of_warsong
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:haste_rating
  • amount:100.00

Stack Uptimes

  • mark_of_warsong_1:3.16%
  • mark_of_warsong_2:3.31%
  • mark_of_warsong_3:3.46%
  • mark_of_warsong_4:3.62%
  • mark_of_warsong_5:3.78%
  • mark_of_warsong_6:3.96%
  • mark_of_warsong_7:4.14%
  • mark_of_warsong_8:4.33%
  • mark_of_warsong_9:4.52%
  • mark_of_warsong_10:4.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159675
  • name:Mark of Warsong
  • tooltip:Haste increased by $w1.
  • description:Haste increased by {$s1=100}.
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
mark_of_warsong_oh (_oh) 5.0 2.2 63.3sec 40.9sec 39.06% 39.07% 2.2(12.9)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_mark_of_warsong_oh
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:haste_rating
  • amount:100.00

Stack Uptimes

  • mark_of_warsong_oh_1:3.17%
  • mark_of_warsong_oh_2:3.32%
  • mark_of_warsong_oh_3:3.46%
  • mark_of_warsong_oh_4:3.62%
  • mark_of_warsong_oh_5:3.79%
  • mark_of_warsong_oh_6:3.96%
  • mark_of_warsong_oh_7:4.14%
  • mark_of_warsong_oh_8:4.33%
  • mark_of_warsong_oh_9:4.53%
  • mark_of_warsong_oh_10:4.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159675
  • name:Mark of Warsong
  • tooltip:Haste increased by $w1.
  • description:Haste increased by {$s1=100}.
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
moderate_insight 7.4 22.0 41.4sec 9.6sec 21.14% 37.80% 22.0(22.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_moderate_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • moderate_insight_1:21.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84746
  • name:Moderate Insight
  • tooltip:Damage dealt increased by $s2%.
  • description:{$@spelldesc84654=Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
shallow_insight 7.7 22.6 40.5sec 9.4sec 21.98% 39.19% 22.6(22.6)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_shallow_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • shallow_insight_1:21.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84745
  • name:Shallow Insight
  • tooltip:Damage dealt increased by {$s1=10}%.
  • description:{$@spelldesc84654=Take advantage of the natural ebb and flow of combat, causing your Sinister Strike to gradually increase your damage dealt by up to {$84747s1=30}%. This maximum effect will last for {$84747d=15 seconds} before fading and beginning the cycle anew.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
slice_and_dice 1.1 8.7 250.5sec 32.1sec 99.64% 100.00% 8.7(8.7)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • slice_and_dice_1:99.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
stealth 6.2 0.0 52.0sec 59.1sec 0.00% 0.02% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:0.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}%. ]?s13975[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%. ][]{$?s31223=false}[Attacks from Stealth and for {$31666d=6 seconds} after deal {$31223s1=10}% more damage. ][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:6.00
  • default_chance:100.00%
turbulent_vial_of_toxin 3.8 0.0 90.4sec 90.5sec 18.31% 18.32% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_turbulent_vial_of_toxin
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:mastery_rating
  • amount:1120.00

Stack Uptimes

  • turbulent_vial_of_toxin_1:18.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:176883
  • name:Turbulent Vial of Toxin
  • tooltip:Mastery increased by {$s1=870}.
  • description:Grants {$s1=870} Mastery for {$d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
vanish 6.1 0.0 48.8sec 48.8sec 0.00% 0.02% 0.0(0.0)

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Ralana
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ralana
ambush Energy 7.1 201.7 28.5 28.5 652.1
eviscerate Energy 36.4 1272.3 35.0 35.0 769.9
eviscerate Combo Points 36.4 181.8 5.0 5.0 5389.3
revealing_strike Energy 12.7 507.9 40.0 40.0 175.3
sinister_strike Energy 132.0 6602.1 50.0 50.0 183.8
slice_and_dice Energy 9.8 244.9 25.0 25.0 0.0
slice_and_dice Combo Points 9.8 43.8 4.5 4.5 0.0
Resource Gains Type Count Total Average Overflow
ambush Combo Points 8.20 14.15 (5.99%) 1.73 0.00 0.00%
revealing_strike Combo Points 12.55 12.55 (5.31%) 1.00 0.00 0.00%
sinister_strike Combo Points 164.51 164.51 (69.62%) 1.00 0.00 0.00%
energy_regen Energy 1117.81 4687.35 (53.90%) 4.19 170.83 3.52%
leech Health 1300.50 0.00 (0.00%) 0.00 13496.07 100.00%
adrenaline_rush Energy 186.73 935.73 (10.76%) 5.01 28.07 2.91%
combat_potency Energy 137.15 1945.67 (22.37%) 14.19 111.63 5.43%
ruthlessness Energy 45.11 1127.70 (12.97%) 25.00 0.00 0.00%
ruthlessness Combo Points 45.10 45.10 (19.09%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 28.90 29.25
Combo Points 0.76 0.75
Combat End Resource Mean Min Max
Energy 29.12 0.00 135.00
Combo Points 4.02 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.6%
shadow_reflection-Energy Cap 1.6%

Procs

Count Interval
Anticipation Charges (wasted) 6.1 45.9sec

Statistics & Data Analysis

Fight Length
Sample Data Ralana Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Ralana Damage Per Second
Count 25000
Mean 20942.44
Minimum 18563.69
Maximum 23413.31
Spread ( max - min ) 4849.62
Range [ ( max - min ) / 2 * 100% ] 11.58%
Standard Deviation 609.1182
5th Percentile 19985.66
95th Percentile 21980.30
( 95th Percentile - 5th Percentile ) 1994.64
Mean Distribution
Standard Deviation 3.8524
95.00% Confidence Intervall ( 20934.89 - 20949.99 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3249
0.1 Scale Factor Error with Delta=300 3167
0.05 Scale Factor Error with Delta=300 12669
0.01 Scale Factor Error with Delta=300 316728
Distribution Chart
DPS(e)
Sample Data Ralana Damage Per Second (Effective)
Count 25000
Mean 20942.44
Minimum 18563.69
Maximum 23413.31
Spread ( max - min ) 4849.62
Range [ ( max - min ) / 2 * 100% ] 11.58%
Damage
Sample Data Ralana Damage
Count 25000
Mean 6290551.91
Minimum 4633285.04
Maximum 8093208.34
Spread ( max - min ) 3459923.30
Range [ ( max - min ) / 2 * 100% ] 27.50%
DTPS
Sample Data Ralana Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ralana Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Ralana Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ralana Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ralana Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ralana Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data RalanaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Ralana Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=frosty_stew
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=draenic_agility
5 0.00 stealth
6 0.00 marked_for_death
7 0.00 slice_and_dice,if=talent.marked_for_death.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|(buff.adrenaline_rush.up&(trinket.proc.any.react|trinket.stacking_proc.any.react|buff.archmages_greater_incandescence_agi.react))
9 0.00 kick
A 1.22 preparation,if=!buff.vanish.up&cooldown.vanish.remains>30
B 3.77 use_item,slot=trinket1
C 0.00 blood_fury
D 0.00 berserking
E 0.00 arcane_torrent,if=energy<60
F 0.00 blade_flurry,if=(active_enemies>=2&!buff.blade_flurry.up)|(active_enemies<2&buff.blade_flurry.up)
G 0.00 shadow_reflection,if=(cooldown.killing_spree.remains<10&combo_points>3)|buff.adrenaline_rush.up
H 7.07 ambush
I 6.07 vanish,if=time>10&(combo_points<3|(talent.anticipation.enabled&anticipation_charges<3)|(combo_points<4|(talent.anticipation.enabled&anticipation_charges<4)))&((talent.shadow_focus.enabled&buff.adrenaline_rush.down&energy<90&energy>=15)|(talent.subterfuge.enabled&energy>=90)|(!talent.shadow_focus.enabled&!talent.subterfuge.enabled&energy>=60))
J 9.80 slice_and_dice,if=buff.slice_and_dice.remains<2|((target.time_to_die>45&combo_points=5&buff.slice_and_dice.remains<12)&buff.deep_insight.down)
K 0.00 call_action_list,name=adrenaline_rush,if=(energy<35|buff.bloodlust.up)&cooldown.killing_spree.remains>10
L 0.00 call_action_list,name=killing_spree,if=(energy<40|(buff.bloodlust.up&time<10)|buff.bloodlust.remains>20)&buff.adrenaline_rush.down&(!talent.shadow_reflection.enabled|cooldown.shadow_reflection.remains>30|buff.shadow_reflection.remains>3)
M 0.00 marked_for_death,if=combo_points<=1&dot.revealing_strike.ticking&(!talent.shadow_reflection.enabled|buff.shadow_reflection.up|cooldown.shadow_reflection.remains>30)
N 0.00 call_action_list,name=generator,if=combo_points<5|!dot.revealing_strike.ticking|(talent.anticipation.enabled&anticipation_charges<=4&buff.deep_insight.down)
O 0.00 call_action_list,name=finisher,if=combo_points=5&dot.revealing_strike.ticking&(buff.deep_insight.up|!talent.anticipation.enabled|(talent.anticipation.enabled&anticipation_charges>=4))
actions.adrenaline_rush
# count action,conditions
P 3.85 adrenaline_rush,if=time_to_die>=44
Q 0.03 adrenaline_rush,if=time_to_die<44&(buff.archmages_greater_incandescence_agi.react|trinket.proc.any.react|trinket.stacking_proc.any.react)
R 0.02 adrenaline_rush,if=time_to_die<=buff.adrenaline_rush.duration*1.5
actions.killing_spree
# count action,conditions
S 5.69 killing_spree,if=time_to_die>=44
T 0.00 killing_spree,if=time_to_die<44&buff.archmages_greater_incandescence_agi.react&buff.archmages_greater_incandescence_agi.remains>=buff.killing_spree.duration
U 0.03 killing_spree,if=time_to_die<44&trinket.proc.any.react&trinket.proc.any.remains>=buff.killing_spree.duration
V 0.00 killing_spree,if=time_to_die<44&trinket.stacking_proc.any.react&trinket.stacking_proc.any.remains>=buff.killing_spree.duration
W 0.03 killing_spree,if=time_to_die<=buff.killing_spree.duration*1.5
actions.generator Combo point generators
# count action,conditions
X 12.70 revealing_strike,if=(combo_points=4&dot.revealing_strike.remains<7.2&(target.time_to_die>dot.revealing_strike.remains+7.2)|(target.time_to_die<dot.revealing_strike.remains+7.2&ticks_remain<2))|!ticking
Y 132.04 sinister_strike,if=dot.revealing_strike.ticking
actions.finisher Combo point finishers
# count action,conditions
Z 0.00 death_from_above
a 36.35 eviscerate

Sample Sequence

01245BHJSPXYYYJYYYYYYYYaYaYYaIHAYXaYYYaYIHYYYaYYYaJYYYXSYYYaYaYYYaYYYJXYYYP8YYBaYYYaYYaYaYYYXIHSaYYaYYYJYYYXYYaYYYYaaYYXaYYYYJYYYIHSYYYaYYPYaXYYaBYaYYYaYYYaYYJYYXYYJYYYYYaYIHSXYaaYYYYaYYYXJYYYYYYaYPYaYYYaaYYBXaYYYaYSYYIHYYaYJ

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points
Pre food Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points
Pre apply_poison Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points
Pre potion Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion
Pre stealth Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion
0:00.000 use_item_turbulent_vial_of_toxin Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion
0:00.000 ambush Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points draenic_agility_potion, turbulent_vial_of_toxin
0:01.006 slice_and_dice Fluffy_Pillow 135.0/135: 100% energy | 2.0/5: 40% combo_points bloodlust, mark_of_warsong_oh(10), draenic_agility_potion, turbulent_vial_of_toxin
0:02.010 killing_spree Fluffy_Pillow 130.2/135: 96% energy | 0.0/5: 0% combo_points bloodlust, slice_and_dice, mark_of_warsong_oh(9), draenic_agility_potion, turbulent_vial_of_toxin
0:05.263 adrenaline_rush Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points bloodlust, slice_and_dice, mark_of_warsong_oh(8), draenic_agility_potion, turbulent_vial_of_toxin
0:05.263 revealing_strike Fluffy_Pillow 135.0/135: 100% energy | 0.0/5: 0% combo_points bloodlust, adrenaline_rush, slice_and_dice, mark_of_warsong_oh(8), draenic_agility_potion, turbulent_vial_of_toxin
0:06.068 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, slice_and_dice, mark_of_warsong_oh(7), draenic_agility_potion, turbulent_vial_of_toxin
0:06.871 sinister_strike Fluffy_Pillow 133.1/135: 99% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile, adrenaline_rush, slice_and_dice, mark_of_warsong_oh(7), draenic_agility_potion, turbulent_vial_of_toxin
0:07.677 sinister_strike Fluffy_Pillow 116.3/135: 86% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(2), adrenaline_rush, slice_and_dice, mark_of_warsong_oh(7), draenic_agility_potion, turbulent_vial_of_toxin
0:08.480 slice_and_dice Fluffy_Pillow 99.3/135: 74% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(3), adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(6), draenic_agility_potion, turbulent_vial_of_toxin
0:09.286 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 1.0/5: 20% combo_points bloodlust, bandits_guile(3), adrenaline_rush, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(6), draenic_agility_potion, turbulent_vial_of_toxin
0:10.090 sinister_strike Fluffy_Pillow 117.8/135: 87% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(4), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(5), draenic_agility_potion, turbulent_vial_of_toxin
0:10.894 sinister_strike Fluffy_Pillow 100.4/135: 74% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(5), draenic_agility_potion, turbulent_vial_of_toxin
0:11.698 sinister_strike Fluffy_Pillow 98.0/135: 73% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(5), draenic_agility_potion, turbulent_vial_of_toxin
0:12.503 sinister_strike Fluffy_Pillow 95.4/135: 71% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong_oh(4), draenic_agility_potion, turbulent_vial_of_toxin
0:13.306 sinister_strike Fluffy_Pillow 77.6/135: 57% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong_oh(4), draenic_agility_potion, turbulent_vial_of_toxin
0:14.111 sinister_strike Fluffy_Pillow 74.9/135: 55% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong_oh(3), draenic_agility_potion, turbulent_vial_of_toxin
0:14.917 sinister_strike Fluffy_Pillow 71.9/135: 53% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong_oh(3), draenic_agility_potion, turbulent_vial_of_toxin
0:15.721 eviscerate Fluffy_Pillow 53.9/135: 40% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(5), exquisite_proficiency, mark_of_warsong_oh(3), draenic_agility_potion
0:16.525 sinister_strike Fluffy_Pillow 75.7/135: 56% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(2), draenic_agility_potion
0:17.331 eviscerate Fluffy_Pillow 57.5/135: 43% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong_oh(2), draenic_agility_potion
0:18.134 sinister_strike Fluffy_Pillow 94.1/135: 70% energy | 2.0/5: 40% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh, draenic_agility_potion
0:18.940 sinister_strike Fluffy_Pillow 75.6/135: 56% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh, draenic_agility_potion
0:19.744 eviscerate Fluffy_Pillow 56.9/135: 42% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh, draenic_agility_potion
0:20.549 vanish Fluffy_Pillow 72.6/135: 54% energy | 1.0/5: 20% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency
0:20.549 ambush Fluffy_Pillow 72.6/135: 54% energy | 1.0/5: 20% combo_points bloodlust, bandits_guile(12), deep_insight, stealth, vanish, slice_and_dice, exquisite_proficiency
0:21.553 preparation Fluffy_Pillow 92.8/135: 69% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10)
0:22.560 sinister_strike Fluffy_Pillow 114.1/135: 85% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(10)
0:23.566 revealing_strike Fluffy_Pillow 100.3/135: 74% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(9)
0:24.571 eviscerate Fluffy_Pillow 111.4/135: 83% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(9)
0:25.576 sinister_strike Fluffy_Pillow 122.4/135: 91% energy | 1.0/5: 20% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(8)
0:26.581 sinister_strike Fluffy_Pillow 123.3/135: 91% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(8)
0:27.584 sinister_strike Fluffy_Pillow 94.1/135: 70% energy | 4.0/5: 80% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(7)
0:28.589 eviscerate Fluffy_Pillow 94.8/135: 70% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(7)
0:29.594 sinister_strike Fluffy_Pillow 105.5/135: 78% energy | 1.0/5: 20% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6)
0:30.598 vanish Fluffy_Pillow 76.0/135: 56% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6)
0:30.598 ambush Fluffy_Pillow 76.0/135: 56% energy | 3.0/5: 60% combo_points bloodlust, bandits_guile(12), deep_insight, stealth, vanish, slice_and_dice, mark_of_warsong(6)
0:31.602 sinister_strike Fluffy_Pillow 81.4/135: 60% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, mark_of_warsong(5)
0:32.607 sinister_strike Fluffy_Pillow 66.8/135: 49% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile, slice_and_dice, anticipation, mark_of_warsong(5)
0:33.610 Waiting 0.700 sec 37.0/135: 27% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(2), slice_and_dice, anticipation(3), mark_of_warsong(4)
0:34.310 sinister_strike Fluffy_Pillow 51.1/135: 38% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(2), slice_and_dice, anticipation(3), mark_of_warsong(4)
0:35.314 Waiting 0.592 sec 21.2/135: 16% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(3), slice_and_dice, anticipation(5), mark_of_warsong(3)
0:35.906 eviscerate Fluffy_Pillow 48.0/135: 36% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(3), slice_and_dice, anticipation(5), mark_of_warsong(3)
0:36.910 sinister_strike Fluffy_Pillow 72.9/135: 54% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(3), slice_and_dice, mark_of_warsong(3)
0:37.914 sinister_strike Fluffy_Pillow 57.7/135: 43% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(4), shallow_insight, slice_and_dice, anticipation, mark_of_warsong(2)
0:38.917 Waiting 1.200 sec 27.5/135: 20% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(5), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong(2)
0:40.117 sinister_strike Fluffy_Pillow 51.0/135: 38% energy | 5.0/5: 100% combo_points bloodlust, bandits_guile(5), shallow_insight, slice_and_dice, anticipation(3), mark_of_warsong
0:41.122 Waiting 1.294 sec 16.1/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(5), mark_of_warsong
0:42.416 eviscerate Fluffy_Pillow 35.3/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(5)
0:43.421 slice_and_dice Fluffy_Pillow 40.3/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice
0:44.425 sinister_strike Fluffy_Pillow 55.2/135: 41% energy | 1.0/5: 20% combo_points bandits_guile(6), shallow_insight, slice_and_dice
0:45.430 Waiting 1.024 sec 20.2/135: 15% energy | 2.0/5: 40% combo_points bandits_guile(7), shallow_insight, slice_and_dice
0:46.454 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 2.0/5: 40% combo_points bandits_guile(7), shallow_insight, slice_and_dice
0:47.458 Waiting 0.400 sec 45.3/135: 34% energy | 3.0/5: 60% combo_points bandits_guile(8), moderate_insight, slice_and_dice
0:47.858 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(8), moderate_insight, slice_and_dice
0:48.861 Waiting 1.690 sec 16.2/135: 12% energy | 4.0/5: 80% combo_points bandits_guile(9), moderate_insight, slice_and_dice
0:50.551 revealing_strike Fluffy_Pillow 41.4/135: 31% energy | 4.0/5: 80% combo_points bandits_guile(9), moderate_insight, slice_and_dice
0:51.555 Waiting 0.500 sec 31.3/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice
0:52.055 killing_spree Fluffy_Pillow 38.7/135: 29% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice
0:55.327 sinister_strike Fluffy_Pillow 132.4/135: 98% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice
0:56.331 sinister_strike Fluffy_Pillow 112.4/135: 83% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation
0:57.337 sinister_strike Fluffy_Pillow 77.3/135: 57% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(2)
0:58.344 eviscerate Fluffy_Pillow 42.3/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(3)
0:59.349 Waiting 0.200 sec 47.3/135: 35% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice
0:59.549 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:00.554 Waiting 0.400 sec 30.2/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:00.954 eviscerate Fluffy_Pillow 36.1/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:01.959 Waiting 0.600 sec 41.1/135: 30% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:02.559 sinister_strike Fluffy_Pillow 50.0/135: 37% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:03.564 Waiting 1.374 sec 15.0/135: 11% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:04.938 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:05.943 Waiting 1.348 sec 15.4/135: 11% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:07.291 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:08.296 Waiting 0.647 sec 15.4/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:08.943 eviscerate Fluffy_Pillow 40.0/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:09.947 Waiting 0.200 sec 44.9/135: 33% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:10.147 sinister_strike Fluffy_Pillow 62.9/135: 47% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:11.153 Waiting 1.500 sec 27.9/135: 21% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice
1:12.653 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 2.0/5: 40% combo_points slice_and_dice
1:13.657 Waiting 2.363 sec 15.1/135: 11% energy | 3.0/5: 60% combo_points bandits_guile, slice_and_dice
1:16.020 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 3.0/5: 60% combo_points bandits_guile, slice_and_dice, exquisite_proficiency
1:17.024 Waiting 1.257 sec 15.2/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
1:18.281 slice_and_dice Fluffy_Pillow 33.9/135: 25% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
1:19.285 revealing_strike Fluffy_Pillow 48.9/135: 36% energy | 1.0/5: 20% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
1:20.289 Waiting 0.800 sec 38.8/135: 29% energy | 2.0/5: 40% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
1:21.089 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 2.0/5: 40% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
1:22.093 Waiting 1.329 sec 15.6/135: 12% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, exquisite_proficiency
1:23.422 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, exquisite_proficiency
1:24.425 Waiting 1.400 sec 30.3/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, exquisite_proficiency
1:25.825 sinister_strike Fluffy_Pillow 66.2/135: 49% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, exquisite_proficiency
1:26.830 adrenaline_rush Fluffy_Pillow 31.1/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency
1:26.830 potion Fluffy_Pillow 31.1/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency
1:26.830 Waiting 0.700 sec 31.1/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency, draenic_agility_potion
1:27.530 sinister_strike Fluffy_Pillow 51.9/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(5), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency, draenic_agility_potion
1:28.334 Waiting 0.900 sec 25.9/135: 19% energy | 5.0/5: 100% combo_points bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(3), exquisite_proficiency, draenic_agility_potion
1:29.234 sinister_strike Fluffy_Pillow 52.6/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(6), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(3), exquisite_proficiency, draenic_agility_potion
1:30.038 use_item_turbulent_vial_of_toxin Fluffy_Pillow 41.6/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(4), exquisite_proficiency, draenic_agility_potion
1:30.038 eviscerate Fluffy_Pillow 41.6/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, anticipation(4), exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:30.843 sinister_strike Fluffy_Pillow 55.5/135: 41% energy | 5.0/5: 100% combo_points bandits_guile(7), adrenaline_rush, shallow_insight, slice_and_dice, exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:31.646 Waiting 0.200 sec 44.4/135: 33% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation, exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:31.846 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation, exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:32.649 Waiting 0.400 sec 39.3/135: 29% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:33.049 sinister_strike Fluffy_Pillow 51.2/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:33.853 Waiting 0.100 sec 25.1/135: 19% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(5), exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:33.953 eviscerate Fluffy_Pillow 43.1/135: 32% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(5), exquisite_proficiency, draenic_agility_potion, turbulent_vial_of_toxin
1:34.758 sinister_strike Fluffy_Pillow 57.0/135: 42% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:35.561 sinister_strike Fluffy_Pillow 60.9/135: 45% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation, draenic_agility_potion, turbulent_vial_of_toxin
1:36.365 Waiting 0.100 sec 34.8/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation(2), draenic_agility_potion, turbulent_vial_of_toxin
1:36.465 eviscerate Fluffy_Pillow 37.8/135: 28% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation(2), draenic_agility_potion, turbulent_vial_of_toxin
1:37.269 sinister_strike Fluffy_Pillow 66.7/135: 49% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:38.073 eviscerate Fluffy_Pillow 55.6/135: 41% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, draenic_agility_potion, turbulent_vial_of_toxin
1:38.877 sinister_strike Fluffy_Pillow 69.8/135: 52% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(10), draenic_agility_potion, turbulent_vial_of_toxin
1:39.681 sinister_strike Fluffy_Pillow 61.0/135: 45% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(10), draenic_agility_potion, turbulent_vial_of_toxin
1:40.485 Waiting 0.400 sec 37.1/135: 28% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(10), draenic_agility_potion, turbulent_vial_of_toxin
1:40.885 sinister_strike Fluffy_Pillow 50.1/135: 37% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(9), draenic_agility_potion, turbulent_vial_of_toxin
1:41.688 revealing_strike Fluffy_Pillow 41.1/135: 30% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(9), draenic_agility_potion, turbulent_vial_of_toxin
1:42.492 vanish Fluffy_Pillow 16.3/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(9), draenic_agility_potion, turbulent_vial_of_toxin
1:42.492 ambush Fluffy_Pillow 16.3/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, stealth, vanish, slice_and_dice, mark_of_warsong(9), draenic_agility_potion, turbulent_vial_of_toxin
1:43.495 killing_spree Fluffy_Pillow 17.4/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(2), mark_of_warsong(8), draenic_agility_potion, turbulent_vial_of_toxin
1:46.758 eviscerate Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(2), mark_of_warsong(7), mark_of_warsong_oh(9), draenic_agility_potion
1:47.762 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6), mark_of_warsong_oh(9), draenic_agility_potion
1:48.766 sinister_strike Fluffy_Pillow 117.0/135: 87% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(6), mark_of_warsong_oh(8), draenic_agility_potion
1:49.769 eviscerate Fluffy_Pillow 83.8/135: 62% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation, mark_of_warsong(5), mark_of_warsong_oh(8), draenic_agility_potion
1:50.774 sinister_strike Fluffy_Pillow 90.5/135: 67% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_warsong(5), mark_of_warsong_oh(7), draenic_agility_potion
1:51.780 sinister_strike Fluffy_Pillow 57.0/135: 42% energy | 3.0/5: 60% combo_points bandits_guile, slice_and_dice, mark_of_warsong(4), mark_of_warsong_oh(7), draenic_agility_potion
1:52.784 Waiting 1.700 sec 23.5/135: 17% energy | 4.0/5: 80% combo_points bandits_guile(2), slice_and_dice, mark_of_warsong(4), mark_of_warsong_oh(6)
1:54.484 sinister_strike Fluffy_Pillow 50.9/135: 38% energy | 4.0/5: 80% combo_points bandits_guile(2), slice_and_dice, mark_of_warsong(3), mark_of_warsong_oh(6)
1:55.489 Waiting 0.510 sec 16.9/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation, mark_of_warsong(2), mark_of_warsong_oh(5)
1:55.999 slice_and_dice Fluffy_Pillow 40.0/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation, mark_of_warsong(2), mark_of_warsong_oh(5)
1:57.002 sinister_strike Fluffy_Pillow 55.8/135: 41% energy | 1.0/5: 20% combo_points bandits_guile(3), slice_and_dice, anticipation, mark_of_warsong, mark_of_warsong_oh(4)
1:58.006 Waiting 1.928 sec 21.4/135: 16% energy | 2.0/5: 40% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, mark_of_warsong, mark_of_warsong_oh(4)
1:59.934 sinister_strike Fluffy_Pillow 51.4/135: 38% energy | 2.0/5: 40% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(10)
2:00.938 Waiting 2.046 sec 17.7/135: 13% energy | 3.0/5: 60% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(10)
2:02.984 sinister_strike Fluffy_Pillow 51.0/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(9)
2:03.988 Waiting 0.500 sec 32.2/135: 24% energy | 4.0/5: 80% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(9)
2:04.488 revealing_strike Fluffy_Pillow 40.2/135: 30% energy | 4.0/5: 80% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(8)
2:05.493 Waiting 1.200 sec 31.3/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(10)
2:06.693 sinister_strike Fluffy_Pillow 50.8/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(10)
2:07.697 Waiting 1.200 sec 32.2/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(9)
2:08.897 sinister_strike Fluffy_Pillow 51.5/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(9)
2:09.903 Waiting 0.200 sec 32.7/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong_oh(8)
2:10.103 eviscerate Fluffy_Pillow 35.9/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong_oh(8)
2:11.111 sinister_strike Fluffy_Pillow 57.0/135: 42% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, mark_of_warsong_oh(8)
2:12.116 Waiting 1.725 sec 23.0/135: 17% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation, mark_of_warsong_oh(7)
2:13.841 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation, mark_of_warsong_oh(6)
2:14.845 Waiting 1.266 sec 16.1/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(6)
2:16.111 sinister_strike Fluffy_Pillow 51.2/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(10)
2:17.116 Waiting 0.800 sec 32.6/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong_oh(10)
2:17.916 sinister_strike Fluffy_Pillow 60.6/135: 45% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong_oh(9)
2:18.922 Waiting 0.400 sec 26.8/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(5), mark_of_warsong_oh(9)
2:19.322 eviscerate Fluffy_Pillow 48.3/135: 36% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(5), mark_of_warsong_oh(9)
2:20.329 eviscerate Fluffy_Pillow 54.4/135: 40% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong_oh(8)
2:21.333 sinister_strike Fluffy_Pillow 60.5/135: 45% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(8)
2:22.339 Waiting 0.600 sec 41.5/135: 31% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(7)
2:22.939 sinister_strike Fluffy_Pillow 51.0/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(7)
2:23.944 Waiting 0.600 sec 31.9/135: 24% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(6)
2:24.544 revealing_strike Fluffy_Pillow 41.3/135: 31% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(6)
2:25.550 Waiting 1.199 sec 17.1/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(6)
2:26.749 eviscerate Fluffy_Pillow 50.8/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(5)
2:27.752 sinister_strike Fluffy_Pillow 56.5/135: 42% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(4)
2:28.757 Waiting 0.900 sec 37.0/135: 27% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(4)
2:29.657 sinister_strike Fluffy_Pillow 50.9/135: 38% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(4)
2:30.662 Waiting 0.600 sec 31.3/135: 23% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(3)
2:31.262 sinister_strike Fluffy_Pillow 55.4/135: 41% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(3)
2:32.267 Waiting 1.000 sec 35.7/135: 26% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(2)
2:33.267 sinister_strike Fluffy_Pillow 50.9/135: 38% energy | 4.0/5: 80% combo_points slice_and_dice, exquisite_proficiency, mark_of_warsong_oh(2)
2:34.271 slice_and_dice Fluffy_Pillow 31.0/135: 23% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh
2:35.275 sinister_strike Fluffy_Pillow 76.1/135: 56% energy | 1.0/5: 20% combo_points bandits_guile, slice_and_dice, exquisite_proficiency, mark_of_warsong_oh
2:36.280 Waiting 0.600 sec 41.1/135: 30% energy | 2.0/5: 40% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
2:36.880 sinister_strike Fluffy_Pillow 50.0/135: 37% energy | 2.0/5: 40% combo_points bandits_guile(2), slice_and_dice, exquisite_proficiency
2:37.885 Waiting 2.373 sec 15.0/135: 11% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, exquisite_proficiency
2:40.258 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, exquisite_proficiency
2:41.263 Waiting 1.256 sec 15.2/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice
2:42.519 vanish Fluffy_Pillow 33.9/135: 25% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice
2:42.519 ambush Fluffy_Pillow 33.9/135: 25% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, stealth, vanish, slice_and_dice
2:43.523 killing_spree Fluffy_Pillow 33.9/135: 25% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2)
2:46.829 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2)
2:47.834 sinister_strike Fluffy_Pillow 115.0/135: 85% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(3)
2:48.839 sinister_strike Fluffy_Pillow 94.9/135: 70% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(4)
2:49.844 eviscerate Fluffy_Pillow 59.9/135: 44% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(5)
2:50.848 sinister_strike Fluffy_Pillow 64.8/135: 48% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice
2:51.852 Waiting 0.400 sec 44.7/135: 33% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation
2:52.252 sinister_strike Fluffy_Pillow 50.7/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation
2:53.256 adrenaline_rush Fluffy_Pillow 15.6/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(2)
2:53.256 Waiting 1.130 sec 15.6/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2)
2:54.386 sinister_strike Fluffy_Pillow 64.2/135: 48% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2)
2:55.192 eviscerate Fluffy_Pillow 38.2/135: 28% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4)
2:55.995 revealing_strike Fluffy_Pillow 52.1/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice
2:56.799 Waiting 0.200 sec 36.0/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation
2:56.999 sinister_strike Fluffy_Pillow 57.0/135: 42% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation
2:57.804 Waiting 0.700 sec 30.9/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2)
2:58.504 sinister_strike Fluffy_Pillow 51.8/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2)
2:59.308 Waiting 0.300 sec 25.7/135: 19% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation(3)
2:59.608 eviscerate Fluffy_Pillow 49.6/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation(3)
3:00.413 use_item_turbulent_vial_of_toxin Fluffy_Pillow 63.6/135: 47% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice
3:00.413 sinister_strike Fluffy_Pillow 63.6/135: 47% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:01.217 eviscerate Fluffy_Pillow 37.5/135: 28% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:02.022 sinister_strike Fluffy_Pillow 51.5/135: 38% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:02.826 Waiting 0.400 sec 40.4/135: 30% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:03.226 sinister_strike Fluffy_Pillow 52.3/135: 39% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:04.031 Waiting 0.800 sec 26.2/135: 19% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:04.831 sinister_strike Fluffy_Pillow 50.0/135: 37% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:05.634 eviscerate Fluffy_Pillow 38.9/135: 29% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:06.438 sinister_strike Fluffy_Pillow 67.9/135: 50% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:07.243 Waiting 0.200 sec 41.8/135: 31% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:07.443 sinister_strike Fluffy_Pillow 62.8/135: 46% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:08.248 Waiting 0.900 sec 36.7/135: 27% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:09.148 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:10.153 Waiting 0.660 sec 15.2/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:10.813 eviscerate Fluffy_Pillow 40.0/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:11.818 Waiting 0.400 sec 44.9/135: 33% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:12.218 sinister_strike Fluffy_Pillow 50.9/135: 38% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:13.223 Waiting 1.815 sec 15.8/135: 12% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, turbulent_vial_of_toxin
3:15.038 sinister_strike Fluffy_Pillow 57.8/135: 43% energy | 2.0/5: 40% combo_points slice_and_dice, turbulent_vial_of_toxin
3:16.042 Waiting 0.249 sec 22.8/135: 17% energy | 3.0/5: 60% combo_points bandits_guile, slice_and_dice
3:16.291 slice_and_dice Fluffy_Pillow 26.5/135: 20% energy | 3.0/5: 60% combo_points bandits_guile, slice_and_dice
3:17.295 Waiting 0.600 sec 41.4/135: 31% energy | 1.0/5: 20% combo_points bandits_guile, slice_and_dice
3:17.895 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 1.0/5: 20% combo_points bandits_guile, slice_and_dice
3:18.897 Waiting 0.400 sec 45.3/135: 34% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice
3:19.297 sinister_strike Fluffy_Pillow 51.2/135: 38% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice
3:20.302 Waiting 1.694 sec 16.2/135: 12% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice
3:21.996 revealing_strike Fluffy_Pillow 41.4/135: 31% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice
3:23.001 Waiting 2.283 sec 16.3/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice
3:25.284 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice
3:26.288 Waiting 1.300 sec 30.2/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation
3:27.588 sinister_strike Fluffy_Pillow 64.6/135: 48% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation
3:28.593 Waiting 0.500 sec 29.5/135: 22% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2)
3:29.093 slice_and_dice Fluffy_Pillow 37.0/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2)
3:30.098 sinister_strike Fluffy_Pillow 51.9/135: 38% energy | 1.0/5: 20% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency
3:31.103 Waiting 1.300 sec 31.9/135: 24% energy | 2.0/5: 40% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency
3:32.403 sinister_strike Fluffy_Pillow 51.2/135: 38% energy | 2.0/5: 40% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency
3:33.410 Waiting 2.093 sec 16.2/135: 12% energy | 3.0/5: 60% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency
3:35.503 sinister_strike Fluffy_Pillow 62.3/135: 46% energy | 3.0/5: 60% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency
3:36.507 Waiting 0.500 sec 28.0/135: 21% energy | 4.0/5: 80% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(10)
3:37.007 sinister_strike Fluffy_Pillow 51.2/135: 38% energy | 4.0/5: 80% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(10)
3:38.011 Waiting 1.165 sec 17.5/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(9)
3:39.176 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(9), moderate_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(9)
3:40.179 Waiting 0.200 sec 32.5/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(8)
3:40.379 eviscerate Fluffy_Pillow 35.7/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(8)
3:41.384 Waiting 0.600 sec 41.7/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(8)
3:41.984 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(10), moderate_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(7)
3:42.988 vanish Fluffy_Pillow 17.3/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(7)
3:42.988 ambush Fluffy_Pillow 17.3/135: 13% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, stealth, vanish, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(7)
3:43.993 killing_spree Fluffy_Pillow 33.2/135: 25% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(6)
3:47.222 revealing_strike Fluffy_Pillow 135.0/135: 100% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong(5)
3:48.226 sinister_strike Fluffy_Pillow 110.6/135: 82% energy | 5.0/5: 100% combo_points bandits_guile(11), moderate_insight, slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(4)
3:49.231 eviscerate Fluffy_Pillow 76.1/135: 56% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, anticipation(5), mark_of_warsong(4)
3:50.236 eviscerate Fluffy_Pillow 96.6/135: 72% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(3)
3:51.239 sinister_strike Fluffy_Pillow 101.9/135: 76% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(3)
3:52.243 sinister_strike Fluffy_Pillow 82.3/135: 61% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(2)
3:53.246 sinister_strike Fluffy_Pillow 62.5/135: 46% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong(2)
3:54.251 Waiting 0.500 sec 42.7/135: 32% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong
3:54.751 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 4.0/5: 80% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong
3:55.755 Waiting 1.349 sec 15.2/135: 11% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice, mark_of_warsong
3:57.104 eviscerate Fluffy_Pillow 35.3/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(12), deep_insight, slice_and_dice
3:58.112 sinister_strike Fluffy_Pillow 55.3/135: 41% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice
3:59.116 Waiting 2.017 sec 20.3/135: 15% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:01.133 sinister_strike Fluffy_Pillow 50.3/135: 37% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:02.138 Waiting 1.655 sec 15.2/135: 11% energy | 3.0/5: 60% combo_points bandits_guile(12), deep_insight, slice_and_dice
4:03.793 sinister_strike Fluffy_Pillow 54.9/135: 41% energy | 3.0/5: 60% combo_points slice_and_dice
4:04.797 Waiting 0.400 sec 34.8/135: 26% energy | 4.0/5: 80% combo_points bandits_guile, slice_and_dice
4:05.197 revealing_strike Fluffy_Pillow 40.8/135: 30% energy | 4.0/5: 80% combo_points bandits_guile, slice_and_dice
4:06.202 slice_and_dice Fluffy_Pillow 45.7/135: 34% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice
4:07.207 sinister_strike Fluffy_Pillow 60.7/135: 45% energy | 1.0/5: 20% combo_points bandits_guile, slice_and_dice
4:08.213 Waiting 0.600 sec 25.6/135: 19% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice
4:08.813 sinister_strike Fluffy_Pillow 50.4/135: 37% energy | 3.0/5: 60% combo_points bandits_guile(2), slice_and_dice, mark_of_warsong_oh(10)
4:09.816 Waiting 1.209 sec 16.7/135: 12% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, mark_of_warsong_oh(10)
4:11.025 sinister_strike Fluffy_Pillow 51.3/135: 38% energy | 4.0/5: 80% combo_points bandits_guile(3), slice_and_dice, mark_of_warsong_oh(9)
4:12.028 Waiting 1.100 sec 32.5/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, mark_of_warsong_oh(9)
4:13.128 sinister_strike Fluffy_Pillow 50.1/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, mark_of_warsong_oh(8)
4:14.133 Waiting 1.200 sec 31.2/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(8)
4:15.333 sinister_strike Fluffy_Pillow 50.2/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(5), shallow_insight, slice_and_dice, anticipation, mark_of_warsong_oh(7)
4:16.338 Waiting 1.200 sec 31.1/135: 23% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(6)
4:17.538 sinister_strike Fluffy_Pillow 50.0/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(6), shallow_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(6)
4:18.542 Waiting 1.294 sec 15.7/135: 12% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(4), mark_of_warsong_oh(5)
4:19.836 eviscerate Fluffy_Pillow 35.9/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, anticipation(4), mark_of_warsong_oh(5)
4:20.841 sinister_strike Fluffy_Pillow 56.5/135: 42% energy | 5.0/5: 100% combo_points bandits_guile(7), shallow_insight, slice_and_dice, mark_of_warsong_oh(4)
4:21.845 adrenaline_rush Fluffy_Pillow 22.0/135: 16% energy | 5.0/5: 100% combo_points bandits_guile(8), moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(4)
4:21.845 Waiting 0.996 sec 22.0/135: 16% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(4)
4:22.841 sinister_strike Fluffy_Pillow 52.6/135: 39% energy | 5.0/5: 100% combo_points bandits_guile(8), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(2), mark_of_warsong_oh(3)
4:23.646 Waiting 0.300 sec 27.2/135: 20% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong_oh(3)
4:23.946 eviscerate Fluffy_Pillow 36.4/135: 27% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(4), mark_of_warsong_oh(3)
4:24.752 sinister_strike Fluffy_Pillow 65.9/135: 49% energy | 5.0/5: 100% combo_points bandits_guile(9), adrenaline_rush, moderate_insight, slice_and_dice, mark_of_warsong_oh(2)
4:25.557 Waiting 0.300 sec 40.3/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation, mark_of_warsong_oh(2)
4:25.857 sinister_strike Fluffy_Pillow 64.4/135: 48% energy | 5.0/5: 100% combo_points bandits_guile(10), adrenaline_rush, moderate_insight, slice_and_dice, anticipation, mark_of_warsong_oh(2)
4:26.661 Waiting 0.400 sec 38.6/135: 29% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong_oh
4:27.061 sinister_strike Fluffy_Pillow 50.6/135: 38% energy | 5.0/5: 100% combo_points bandits_guile(11), adrenaline_rush, moderate_insight, slice_and_dice, anticipation(3), mark_of_warsong_oh
4:27.867 eviscerate Fluffy_Pillow 42.1/135: 31% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, anticipation(4), mark_of_warsong(10), mark_of_warsong_oh
4:28.671 eviscerate Fluffy_Pillow 58.4/135: 43% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(10)
4:29.477 sinister_strike Fluffy_Pillow 74.5/135: 55% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(9)
4:30.281 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(9)
4:31.086 use_item_turbulent_vial_of_toxin Fluffy_Pillow 26.5/135: 20% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(8)
4:31.086 Waiting 0.500 sec 26.5/135: 20% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(8), turbulent_vial_of_toxin
4:31.586 revealing_strike Fluffy_Pillow 42.5/135: 31% energy | 4.0/5: 80% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(8), turbulent_vial_of_toxin
4:32.389 eviscerate Fluffy_Pillow 58.1/135: 43% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(8), turbulent_vial_of_toxin
4:33.192 sinister_strike Fluffy_Pillow 73.8/135: 55% energy | 1.0/5: 20% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(7), turbulent_vial_of_toxin
4:33.997 Waiting 0.100 sec 49.3/135: 37% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(7), turbulent_vial_of_toxin
4:34.097 sinister_strike Fluffy_Pillow 52.5/135: 39% energy | 2.0/5: 40% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(7), turbulent_vial_of_toxin
4:34.900 Waiting 0.700 sec 28.0/135: 21% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(7), turbulent_vial_of_toxin
4:35.600 sinister_strike Fluffy_Pillow 65.0/135: 48% energy | 3.0/5: 60% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, mark_of_warsong(6), turbulent_vial_of_toxin
4:36.404 eviscerate Fluffy_Pillow 40.3/135: 30% energy | 5.0/5: 100% combo_points bandits_guile(12), adrenaline_rush, deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(6), turbulent_vial_of_toxin
4:37.208 Waiting 0.100 sec 49.9/135: 37% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(5), turbulent_vial_of_toxin
4:37.308 sinister_strike Fluffy_Pillow 51.4/135: 38% energy | 1.0/5: 20% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(5), turbulent_vial_of_toxin
4:38.311 killing_spree Fluffy_Pillow 17.0/135: 13% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(5), turbulent_vial_of_toxin
4:41.703 sinister_strike Fluffy_Pillow 135.0/135: 100% energy | 2.0/5: 40% combo_points bandits_guile(12), deep_insight, slice_and_dice, exquisite_proficiency, mark_of_warsong(3), turbulent_vial_of_toxin
4:42.707 sinister_strike Fluffy_Pillow 115.4/135: 85% energy | 3.0/5: 60% combo_points slice_and_dice, exquisite_proficiency, mark_of_warsong(3), turbulent_vial_of_toxin
4:43.712 vanish Fluffy_Pillow 80.6/135: 60% energy | 4.0/5: 80% combo_points bandits_guile, slice_and_dice, exquisite_proficiency, mark_of_warsong(2), turbulent_vial_of_toxin
4:43.712 ambush Fluffy_Pillow 80.6/135: 60% energy | 4.0/5: 80% combo_points bandits_guile, stealth, vanish, slice_and_dice, exquisite_proficiency, mark_of_warsong(2), turbulent_vial_of_toxin
4:44.717 sinister_strike Fluffy_Pillow 50.9/135: 38% energy | 5.0/5: 100% combo_points bandits_guile, slice_and_dice, anticipation, exquisite_proficiency, mark_of_warsong(2), turbulent_vial_of_toxin
4:45.722 Waiting 0.300 sec 46.0/135: 34% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong, turbulent_vial_of_toxin
4:46.022 sinister_strike Fluffy_Pillow 50.5/135: 37% energy | 5.0/5: 100% combo_points bandits_guile(2), slice_and_dice, anticipation(3), exquisite_proficiency, mark_of_warsong, turbulent_vial_of_toxin
4:47.027 Waiting 0.200 sec 31.9/135: 24% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(10)
4:47.227 eviscerate Fluffy_Pillow 35.1/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, anticipation(4), exquisite_proficiency, mark_of_warsong(10)
4:48.232 sinister_strike Fluffy_Pillow 56.5/135: 42% energy | 5.0/5: 100% combo_points bandits_guile(3), slice_and_dice, exquisite_proficiency, mark_of_warsong(9)
4:49.238 Waiting 0.741 sec 22.7/135: 17% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(9)
4:49.979 slice_and_dice Fluffy_Pillow 34.7/135: 26% energy | 5.0/5: 100% combo_points bandits_guile(4), shallow_insight, slice_and_dice, anticipation(2), exquisite_proficiency, mark_of_warsong(9)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 1262 1202 1202
Agility 3955 3504 3402 (1188)
Stamina 4019 3654 3654
Intellect 746 711 711
Spirit 533 533 533
Health 241140 219240 0
Energy 135 135 0
Combo Points 5 5 0
Crit 24.85% 19.85% 533
Haste 18.08% 11.39% 1029
Multistrike 7.77% 2.77% 183
Damage / Heal Versatility 6.69% 3.69% 480
Attack Power 6091 4906 0
Mastery 35.20% 25.20% 506
Armor 844 844 844

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Cloak and Dagger Shadowstep Burst of Speed
75 Prey on the Weak Internal Bleeding Dirty Tricks
90 Shuriken Toss Marked for Death Anticipation
100 Venom Rush Shadow Reflection Death from Above

Profile

rogue="Ralana"
origin="http://eu.battle.net/wow/en/character/forscherliga/Ralana/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/114/47730546-avatar.jpg"
level=100
race=night_elf
role=attack
position=back
professions=engineering=659/jewelcrafting=659
talents=http://eu.battle.net/wow/en/tool/talent-calculator#cZ!2221020
glyphs=energy/feint/disappearance/poisons/safe_fall/decoy
spec=combat

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=frosty_stew
actions.precombat+=/apply_poison,lethal=deadly
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_agility
actions.precombat+=/stealth
actions.precombat+=/marked_for_death
actions.precombat+=/slice_and_dice,if=talent.marked_for_death.enabled

# Executed every time the actor is available.

actions=potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|(buff.adrenaline_rush.up&(trinket.proc.any.react|trinket.stacking_proc.any.react|buff.archmages_greater_incandescence_agi.react))
actions+=/kick
actions+=/preparation,if=!buff.vanish.up&cooldown.vanish.remains>30
actions+=/use_item,slot=trinket1
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=energy<60
actions+=/blade_flurry,if=(active_enemies>=2&!buff.blade_flurry.up)|(active_enemies<2&buff.blade_flurry.up)
actions+=/shadow_reflection,if=(cooldown.killing_spree.remains<10&combo_points>3)|buff.adrenaline_rush.up
actions+=/ambush
actions+=/vanish,if=time>10&(combo_points<3|(talent.anticipation.enabled&anticipation_charges<3)|(combo_points<4|(talent.anticipation.enabled&anticipation_charges<4)))&((talent.shadow_focus.enabled&buff.adrenaline_rush.down&energy<90&energy>=15)|(talent.subterfuge.enabled&energy>=90)|(!talent.shadow_focus.enabled&!talent.subterfuge.enabled&energy>=60))
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<2|((target.time_to_die>45&combo_points=5&buff.slice_and_dice.remains<12)&buff.deep_insight.down)
actions+=/call_action_list,name=adrenaline_rush,if=(energy<35|buff.bloodlust.up)&cooldown.killing_spree.remains>10
actions+=/call_action_list,name=killing_spree,if=(energy<40|(buff.bloodlust.up&time<10)|buff.bloodlust.remains>20)&buff.adrenaline_rush.down&(!talent.shadow_reflection.enabled|cooldown.shadow_reflection.remains>30|buff.shadow_reflection.remains>3)
actions+=/marked_for_death,if=combo_points<=1&dot.revealing_strike.ticking&(!talent.shadow_reflection.enabled|buff.shadow_reflection.up|cooldown.shadow_reflection.remains>30)
actions+=/call_action_list,name=generator,if=combo_points<5|!dot.revealing_strike.ticking|(talent.anticipation.enabled&anticipation_charges<=4&buff.deep_insight.down)
actions+=/call_action_list,name=finisher,if=combo_points=5&dot.revealing_strike.ticking&(buff.deep_insight.up|!talent.anticipation.enabled|(talent.anticipation.enabled&anticipation_charges>=4))

actions.adrenaline_rush=adrenaline_rush,if=time_to_die>=44
actions.adrenaline_rush+=/adrenaline_rush,if=time_to_die<44&(buff.archmages_greater_incandescence_agi.react|trinket.proc.any.react|trinket.stacking_proc.any.react)
actions.adrenaline_rush+=/adrenaline_rush,if=time_to_die<=buff.adrenaline_rush.duration*1.5

actions.killing_spree=killing_spree,if=time_to_die>=44
actions.killing_spree+=/killing_spree,if=time_to_die<44&buff.archmages_greater_incandescence_agi.react&buff.archmages_greater_incandescence_agi.remains>=buff.killing_spree.duration
actions.killing_spree+=/killing_spree,if=time_to_die<44&trinket.proc.any.react&trinket.proc.any.remains>=buff.killing_spree.duration
actions.killing_spree+=/killing_spree,if=time_to_die<44&trinket.stacking_proc.any.react&trinket.stacking_proc.any.remains>=buff.killing_spree.duration
actions.killing_spree+=/killing_spree,if=time_to_die<=buff.killing_spree.duration*1.5

# Combo point generators

actions.generator=revealing_strike,if=(combo_points=4&dot.revealing_strike.remains<7.2&(target.time_to_die>dot.revealing_strike.remains+7.2)|(target.time_to_die<dot.revealing_strike.remains+7.2&ticks_remain<2))|!ticking
actions.generator+=/sinister_strike,if=dot.revealing_strike.ticking

# Combo point finishers

actions.finisher=death_from_above
actions.finisher+=/eviscerate

head=nightvision_mechshades,id=109171,bonus_id=179/525/531
neck=shifting_taladite_pendant,id=115800,bonus_id=204/525/540,enchant=40haste
shoulders=spaulders_of_burning_focus,id=109934,bonus_id=524
back=deadshot_greatcloak,id=109905,bonus_id=524,enchant=100haste
chest=bloodfeather_chestwrap,id=109885,bonus_id=524
shirt=precious_ribbon,id=52019
tabard=stormwind_tabard,id=118365
wrists=spineripper_bracers,id=116209
hands=treacherous_palms,id=113832,bonus_id=43/566
waist=bloodfeather_girdle,id=109830,bonus_id=524
legs=leafmender_legwraps,id=109812,bonus_id=524
feet=blackwater_boots,id=109799,bonus_id=40/499/523/524,gems=35haste
finger1=signet_of_radiant_leaves,id=109762,bonus_id=499/523/524,gems=35haste,enchant=30haste
finger2=timeless_solium_band_of_the_assassin,id=118297,enchant=50haste
trinket1=turbulent_vial_of_toxin,id=114488,bonus_id=560
trinket2=voidtouched_totem,id=114891
main_hand=the_bladefist,id=113591,bonus_id=41/566,enchant=mark_of_warsong
off_hand=the_bladefist,id=113591,bonus_id=566,enchant=mark_of_warsong

# Gear Summary
# gear_agility=2050
# gear_stamina=2764
# gear_crit_rating=533
# gear_haste_rating=980
# gear_mastery_rating=506
# gear_armor=844
# gear_multistrike_rating=183
# gear_versatility_rating=480
# gear_leech_rating=59
# gear_avoidance_rating=76

Mîrai

Mîrai : 26817 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
26817.2 26817.2 10.1 / 0.038% 3126.8 / 11.7% 1226.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
20.6 20.6 Energy 41.33% 40.6 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Mîrai/advanced
Talents
  • 15: Subterfuge
  • 30: Nerve Strike
  • 45: Cheat Death
  • 60: Shadowstep
  • 75: Prey on the Weak
  • 90: Anticipation
  • 100: Shadow Reflection
  • Talent Calculator
Glyphs
  • Glyph of Hemorrhaging Veins
  • Glyph of Cloak of Shadows
  • Glyph of Energy
  • Glyph of Poisons
  • Glyph of Safe Fall
Professions
  • leatherworking: 700
  • jewelcrafting: 700

Charts

http://6.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=M%C3%AErai+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x240&chd=t:80700|42876|29098|12522|10559|5144|2473&chds=0,161400&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++80700++rupture,C79C6E,0,0,15|t++42876++eviscerate,C79C6E,1,0,15|t++29098++ambush,C79C6E,2,0,15|t++12522++garrote,C79C6E,3,0,15|t++10559++backstab,C79C6E,4,0,15|t++5144++auto_attack_mh,C79C6E,5,0,15|t++2473++auto_attack_oh,C79C6E,6,0,15& http://7.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=M%C3%AErai+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:20,19,18,12,12,10,4,4,2,2,2,2,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=auto_attack_mh|eviscerate|rupture|ambush|backstab|auto_attack_oh|deadly_poison_instant|deadly_poison_dot|shadow_reflection: ambush|shadow_reflection: rupture|shattered_bleed|shadow_reflection: eviscerate|garrote|shadow_reflection: backstab&
http://9.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=M%C3%AErai+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:eimruw0358764522zzvtrpnkihdcbaaZZZaZaaZaaZZYYYYWWWWVWWVWVUVUUVUVVVWXXXXYXWXWWWVVUTTTSRRQQPPPOOOOOOOOOOOOOOOOPPOOPSTWWYabegjkmopqrsuvusrpponnljihgfedbbaZZYYYXWVUTTSRQQPPPOOOOPQQRRSSTUUVWXXXYYYZYYXWWVUUTTSRQQPPPOOOOOOOPPPPPPPPPPPPPQQQRSSSTTUUVWXXYZabcdeffgghiijjkkkjjihgfedcbaYXWVTTRRQPPPPPPPPPPQQQQQQQQRRRRRSSSSTTTTUUUVVVVVVVVVUUUUUVVVVVVVVUUUUUUUUUUUUUUUUUUUUUUUTSRRQPONLK&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.423206,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=26817|max=63367&chxp=1,1,42,100 http://2.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=M%C3%AErai+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,5,7,17,30,60,92,150,216,303,421,534,743,843,1023,1071,1283,1402,1425,1363,1399,1432,1309,1229,1196,1085,1032,973,823,728,618,469,427,336,273,227,139,87,75,57,26,29,13,13,7,2,4,2,0,1&chds=0,1432&chbh=5&chxt=x&chxl=0:|min=24242|avg=26817|max=30248&chxp=0,1,43,100& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=M%C3%AErai+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:27.6,11.4,10.7,5.6,2.6,0.4,0.3,41.3&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=backstab 83.1s|eviscerate 34.4s|ambush 32.1s|rupture 16.8s|slice_and_dice 7.9s|preparation 1.2s|garrote 1.0s|waiting 124.4s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% M-Count M-Hit M-Crit M-Crit% Up%
Mîrai 26817
ambush 3121 11.6% 32.0 9.20sec 29229 29098 Direct 32.0 19776 42484 25804 26.5% 0.0% 12.9 6505 13865 26.5%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.98 31.98 0.00 0.00 1.0045 0.0000 934723.30 1011174.83 7.56 29098.26 29098.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.44 26.53% 13865.33 8901 18823 13441.67 0 18823 47629 47629 0.00
multistrike 9.51 73.47% 6504.98 4363 9227 6511.89 0 9227 61889 61889 0.00
hit 23.49 73.45% 19776.14 9464 30757 19800.15 15921 23356 464532 509585 8.85
crit 8.49 26.55% 42483.83 19307 62744 42593.76 0 62744 360673 392072 8.06
 
DPS Timeline Chart
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5|(talent.anticipation.enabled&anticipation_charges<3)&(time<1.2|buff.shadow_dance.up|time>5)
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage to the target (damage increased 40% if a dagger is equipped){$?s138106=false}[ and causes you to appear behind the target][]. Awards {$s3=2} combo $lpoint:points;.{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.11
 
auto_attack_mh 5120 19.1% 321.6 0.94sec 4779 5144 Direct 321.6 3909 8483 4283 24.4% 19.0% 105.6 1179 2544 24.4%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 321.58 321.58 0.00 0.00 0.9292 0.0000 1537007.71 1818109.09 15.46 5143.95 5143.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 25.76 24.39% 2544.46 1396 4553 2548.44 1858 3378 65545 76560 14.44
multistrike 79.85 75.61% 1178.94 685 2232 1180.30 975 1416 94142 112417 16.25
hit 182.03 56.61% 3909.44 2282 7440 3913.65 3610 4297 711649 851741 16.43
crit 78.47 24.40% 8483.46 4655 15177 8497.28 7314 9873 665673 777391 14.36
miss 61.08 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2460 9.2% 318.8 0.94sec 2317 2473 Direct 318.8 1893 4119 2076 24.4% 19.0% 104.6 571 1235 24.4%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 318.77 318.77 0.00 0.00 0.9366 0.0000 738478.76 873952.19 15.50 2473.46 2473.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 25.55 24.41% 1234.68 675 2227 1236.26 854 1701 31542 36851 14.47
multistrike 79.10 75.59% 570.62 331 1092 571.28 483 669 45133 53962 16.36
hit 180.58 56.65% 1892.91 1103 3639 1894.94 1740 2078 341816 409441 16.50
crit 77.69 24.37% 4118.83 2250 7424 4126.33 3465 4923 319987 373698 14.35
miss 60.50 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
backstab 2918 10.9% 82.7 3.47sec 10606 10559 Direct 82.7 7464 15967 9455 23.4% 0.0% 33.6 2239 4795 23.4%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.72 82.72 0.00 0.00 1.0045 0.0000 877319.58 1087856.33 19.35 10558.67 10558.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 7.85 23.37% 4795.16 2889 8164 4798.09 0 8164 37628 45969 18.40
multistrike 25.72 76.63% 2238.81 1416 4002 2240.68 1700 3037 57592 72093 20.14
hit 63.35 76.58% 7463.55 4721 13341 7469.15 6634 8262 472780 591746 20.08
crit 19.37 23.42% 15966.68 9631 27215 15996.69 11558 21821 309320 378048 18.20
 
DPS Timeline Chart
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Backstab the target, causing $sw2 Physical damage. Must not be in front of the target. Awards {$s3=1} combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.17
 
deadly_poison_dot 907 3.4% 200.3 1.50sec 1361 0 Periodic 99.5 1924 4071 2444 24.2% 0.0% 40.3 577 1222 24.2% 99.2%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 200.32 200.32 99.46 99.46 0.0000 3.0000 272626.36 272626.36 0.00 913.72 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 200.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.8 24.25% 1221.80 876 1983 1223.51 0 1983 11948 11948 0.00
multistrike 30.6 75.75% 577.33 429 972 577.79 512 681 17639 17639 0.00
hit 75.4 75.81% 1924.30 37 3240 1925.69 1806 2039 145087 145087 0.00
crit 24.1 24.19% 4071.12 230 6609 4077.29 3503 4870 97952 97952 0.00
 
DPS Timeline Chart
 

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$2823d=3600 seconds}. Each strike has a {$2823h=30}% chance of poisoning the enemy for ${$2818m1*4} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.250140
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
deadly_poison_instant 949 3.5% 199.3 1.50sec 1430 0 Direct 199.3 1001 2126 1275 24.4% 0.0% 80.7 300 638 24.4%  

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 199.32 199.32 0.00 0.00 0.0000 0.0000 285010.16 285010.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 19.72 24.42% 637.53 451 1020 638.26 533 805 12569 12569 0.00
multistrike 61.01 75.58% 300.14 221 500 300.41 271 348 18313 18313 0.00
hit 150.74 75.63% 1000.75 736 1667 1001.60 939 1082 150855 150855 0.00
crit 48.58 24.37% 2125.77 1502 3400 2128.29 1896 2485 103273 103273 0.00
 
DPS Timeline Chart
 

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.
 
eviscerate 4912 18.3% 34.2 8.65sec 43068 42876 Direct 34.2 29832 64946 38404 24.4% 0.0% 13.9 8950 19438 24.5%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.25 34.25 0.00 0.00 1.0045 0.0000 1474968.87 1677148.43 12.05 42875.76 42875.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.40 24.52% 19437.60 11424 35863 18810.94 0 35863 66063 74306 11.53
multistrike 10.46 75.48% 8950.37 5600 17580 8956.85 5600 15487 93656 107343 12.93
hit 25.89 75.59% 29831.67 18667 58599 29848.79 22946 36193 772226 884914 12.75
crit 8.36 24.41% 64945.93 38080 119542 65161.32 0 119542 543024 610585 11.22
 
DPS Timeline Chart
 

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point: 1 point : ${($AP*0.577)*$<mult>} damage 2 points: ${($AP*0.577)*$<mult>*2} damage 3 points: ${($AP*0.577)*$<mult>*3} damage 4 points: ${($AP*0.577)*$<mult>*4} damage 5 points: ${($AP*0.577)*$<mult>*5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.507760
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
garrote 43 0.2% 1.0 0.00sec 12577 12522 Periodic 9.0 924 1893 1246 33.2% 0.0% 3.7 277 567 33.0% 6.0%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 9.00 9.00 1.0045 2.0000 12572.47 12572.47 0.00 661.81 12522.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.2 32.97% 567.09 476 619 403.62 0 619 684 684 0.00
multistrike 2.5 67.03% 277.33 233 304 256.72 0 304 680 680 0.00
hit 6.0 66.81% 924.33 777 1012 923.77 0 1012 5556 5556 0.00
crit 3.0 33.19% 1892.78 1585 2064 1841.86 0 2064 5653 5653 0.00
 
DPS Timeline Chart
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&time<1
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:$w1 damage every $t1 seconds.
  • description:Garrote the enemy, silencing them for {$1330d=3 seconds} and causing $o1 damage over {$d=18 seconds}. Awards {$s3=1} combo $lpoint:points;{$?s138106=false}[ and causes you to appear behind the target][].{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.078000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
 
rupture 4504 16.8% 16.7 18.36sec 81059 80700 Periodic 192.3 4940 10467 6278 24.2% 0.0% 77.9 1482 3137 24.2% 127.8%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.70 16.70 192.27 192.27 1.0045 2.0000 1353740.86 1353740.86 0.00 3373.34 80699.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 18.8 24.19% 3137.14 2605 5322 3141.76 2629 4163 59107 59107 0.00
multistrike 59.1 75.81% 1482.19 1277 2609 1483.19 1343 1712 87534 87534 0.00
hit 145.7 75.78% 4939.60 4257 8696 4943.26 4647 5319 719681 719681 0.00
crit 46.6 24.22% 10466.63 8685 17740 10479.63 9393 12052 487419 487419 0.00
 
DPS Timeline Chart
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<duration*0.3)&active_enemies<=3&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time. Lasts longer per combo point: 1 point : ${$<bonus>*1*0.0685*$AP*0.5*8} over 8 sec 2 points: ${$<bonus>*2*0.0685*$AP*0.5*12} over 12 sec 3 points: ${$<bonus>*3*0.0685*$AP*0.5*16} over 16 sec 4 points: ${$<bonus>*4*0.0685*$AP*0.5*20} over 20 sec 5 points: ${$<bonus>*5*0.0685*$AP*0.5*24} over 24 sec{$?s79134=false}[ While you have poisoned your target, this damage deals {$79136s1=0} additional Nature damage and grants you {$79134s2=10} Energy. You gain additional Energy if a target dies with Rupture active.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.068500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shattered_bleed 409 1.5% 17.0 18.04sec 7242 0 Direct 17.0 1647 3364 2064 24.3% 0.0% 6.9 494 1009 24.4%  
Periodic 94.4 789 0 789 0.0% 0.0% 38.2 240 0 0.0% 31.4%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.97 16.97 94.37 94.37 0.0000 1.0000 122913.79 122913.79 0.00 1302.41 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.67 24.38% 1009.38 978 1124 818.45 0 1124 1691 1691 0.00
multistrike 5.19 75.62% 494.23 479 551 490.96 0 551 2567 2567 0.00
hit 12.85 75.72% 1646.83 1597 1837 1647.58 1597 1789 21162 21162 0.00
crit 4.12 24.28% 3364.46 3259 3747 3319.57 0 3747 13865 13865 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 38.2 100.00% 239.61 240 240 239.61 240 240 9151 9151 0.00
hit 94.4 100.00% 789.17 1 799 789.45 758 799 74477 74477 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - shadow_reflection 9898 / 1475
ambush 4251 2.4% 10.6 23.99sec 17949 0 Direct 10.6 12062 24435 16000 31.8% 0.0% 4.3 3619 7328 32.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.58 10.58 0.00 0.00 0.0000 0.0000 189912.74 291865.90 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.37 31.98% 7327.70 6377 7575 5535.28 0 7575 10056 15454 26.35
multistrike 2.92 68.02% 3618.67 3189 3788 3447.68 0 3788 10565 16236 33.19
hit 7.21 68.17% 12061.80 10629 12625 12096.89 0 12625 87002 133709 34.93
crit 3.37 31.83% 24434.85 21257 25250 24002.20 0 25250 82290 126467 34.23
 
DPS Timeline Chart
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage to the target (damage increased 40% if a dagger is equipped){$?s138106=false}[ and causes you to appear behind the target][]. Awards {$s3=2} combo $lpoint:points;.{$?s91023=false}[ For the next {$91021d=10 seconds}, your attacks bypass up to {$91021s1=100}% of that enemy's armor.][]
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.11
 
backstab 17 0.0% 0.1 45.74sec 8583 0 Direct 0.1 5780 11740 7639 31.2% 0.0% 0.0 1722 3532 30.4%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.09 0.09 0.00 0.00 0.0000 0.0000 760.10 1168.16 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.01 30.36% 3532.38 3181 3779 37.55 0 3779 39 61 0.37
multistrike 0.03 69.64% 1722.02 1591 1889 39.65 0 1889 44 68 0.80
hit 0.06 68.79% 5779.62 5302 6298 336.80 0 6298 352 541 2.03
crit 0.03 31.21% 11739.51 10604 12595 317.52 0 12595 324 499 0.94
 
DPS Timeline Chart
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Backstab the target, causing $sw2 Physical damage. Must not be in front of the target. Awards {$s3=1} combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.17
 
eviscerate 2592 1.4% 2.9 95.18sec 39267 0 Direct 2.9 26523 53847 35002 31.0% 0.0% 1.2 7961 16175 31.4%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.94 2.94 0.00 0.00 0.0000 0.0000 115558.75 177595.56 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.37 31.40% 16174.58 13534 17407 5115.10 0 17407 6048 9296 11.04
multistrike 0.82 68.60% 7960.93 6767 8703 4533.45 0 8703 6504 9996 19.84
hit 2.03 68.97% 26522.89 22557 29012 25061.16 0 29012 53833 82733 32.80
crit 0.91 31.03% 53846.91 45114 58023 35218.94 0 58023 49173 75571 22.78
 
DPS Timeline Chart
 

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that causes damage per combo point: 1 point : ${($AP*0.577)*$<mult>} damage 2 points: ${($AP*0.577)*$<mult>*2} damage 3 points: ${($AP*0.577)*$<mult>*3} damage 4 points: ${($AP*0.577)*$<mult>*4} damage 5 points: ${($AP*0.577)*$<mult>*5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.577000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
rupture 3038 1.7% 2.0 146.41sec 68366 0 Periodic 23.1 4085 8599 5224 25.2% 0.0% 9.4 1226 2580 25.2% 15.3%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.98 1.98 23.08 23.08 0.0000 2.0000 135225.09 135225.09 0.00 2930.12 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.4 25.16% 2580.12 1967 3493 2278.56 0 3493 6080 6080 0.00
multistrike 7.0 74.84% 1226.38 983 1747 1222.79 0 1747 8596 8596 0.00
hit 17.3 74.76% 4085.05 3278 5822 4094.19 0 5254 70474 70474 0.00
crit 5.8 25.24% 8598.74 6556 11645 8611.65 0 11645 50075 50075 0.00
 
DPS Timeline Chart
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time. Lasts longer per combo point: 1 point : ${$<bonus>*1*0.0685*$AP*0.5*8} over 8 sec 2 points: ${$<bonus>*2*0.0685*$AP*0.5*12} over 12 sec 3 points: ${$<bonus>*3*0.0685*$AP*0.5*16} over 16 sec 4 points: ${$<bonus>*4*0.0685*$AP*0.5*20} over 20 sec 5 points: ${$<bonus>*5*0.0685*$AP*0.5*24} over 24 sec{$?s79134=false}[ While you have poisoned your target, this damage deals {$79136s1=0} additional Nature damage and grants you {$79134s2=10} Energy. You gain additional Energy if a target dies with Rupture active.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.068500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Mîrai
draenic_agility_potion 2.0 0.00sec

Stats details: draenic_agility_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156423
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156423
  • name:Draenic Agility Potion
  • school:physical
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
 
premeditation 8.7 37.44sec

Stats details: premeditation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.72 8.72 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 8.72 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: premeditation

Static Values
  • id:14183
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:combo_points<=4&!(buff.shadow_dance.up&energy>100&combo_points>1)&!buff.subterfuge.up|(buff.subterfuge.up&debuff.find_weakness.up)
Spelldata
  • id:14183
  • name:Premeditation
  • school:physical
  • tooltip:
  • description:Adds {$s1=2} combo points. You must add to or use those combo points within {$d=18 seconds} or the combo points are lost.
 
preparation 1.2 312.42sec

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.16 1.16 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 1.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.vanish.up&cooldown.vanish.remains>60
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:
  • description:Immediately resets the cooldown on your Sprint, Vanish, and Evasion.
 
shadow_dance 5.3 61.97sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.29 5.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 5.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadow_dance

Static Values
  • id:51713
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy>=50&buff.stealth.down&buff.vanish.down&debuff.find_weakness.down|(buff.bloodlust.up&(dot.hemorrhage.ticking|dot.garrote.ticking|dot.rupture.ticking))
Spelldata
  • id:51713
  • name:Shadow Dance
  • school:physical
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by {$s2=20}.
  • description:Enter the Shadow Dance for {$d=8 seconds}, allowing the use of abilities that ordinarily require Stealth, and reducing the Energy cost of Ambush by {$s2=20}.
 
shadow_reflection 2.9 124.46sec

Stats details: shadow_reflection

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.88 2.88 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 2.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shadow_reflection

Static Values
  • id:152151
  • school:physical
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.shadow_dance.up
Spelldata
  • id:152151
  • name:Shadow Reflection
  • school:physical
  • tooltip:You have a Shadow Reflection, watching you and replicating your abilities used.
  • description:Summon a shadow of yourself on the target that will watch you and memorize your offensive ability usage for the next 8 sec. After this time, it will mimic the memorized abilities on its target over the next 8 sec.
 
slice_and_dice 8.8 36.24sec

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.83 8.83 0.00 0.00 0.8908 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 8.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
 
vanish 4.2 72.61sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.19 4.19 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
none 4.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.shadow_focus.enabled&energy>=45&energy<=75&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for {$11327d=3 seconds}. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
anticipation 34.5 39.7 8.8sec 4.0sec 34.70% 34.71% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_anticipation
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • anticipation_1:12.68%
  • anticipation_2:6.53%
  • anticipation_3:5.79%
  • anticipation_4:6.11%
  • anticipation_5:3.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115189
  • name:Anticipation
  • tooltip:Your next offensive finishing move will grant you {$s1=1} combo points on that target.
  • description:{$@spelldesc114015=When one of your attacks generates a combo point while you already have 5 combo points, you gain an Anticipation charge. Performing an offensive finishing move consumes all Anticipation charges and grants you a combo point for each.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 27.33% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_agility_potion 2.0 0.0 123.5sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_draenic_agility_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1000.00

Stack Uptimes

  • draenic_agility_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156423
  • name:Draenic Agility Potion
  • tooltip:Agility increased by {$s1=1000}.
  • description:Increases your agility by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
lucky_flip 2.9 0.0 124.5sec 124.5sec 18.57% 18.59% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_lucky_flip
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:1467.00

Stack Uptimes

  • lucky_flip_1:18.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177597
  • name:"Lucky" Flip
  • tooltip:Increases Agility by {$s1=870}.
  • description:Increases your Agility by {$s1=870} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
mark_of_bleeding_hollow 8.9 5.0 35.4sec 21.9sec 43.85% 43.85% 5.0(5.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_mark_of_bleeding_hollow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:mastery_rating
  • amount:500.00

Stack Uptimes

  • mark_of_bleeding_hollow_1:43.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173322
  • name:Mark of Bleeding Hollow
  • tooltip:Mastery increased by $w1.
  • description:Mastery increased by {$s1=500}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
master_of_subtlety 5.1 0.0 61.1sec 61.1sec 10.16% 10.17% 5.0(5.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31666
  • name:Master of Subtlety
  • tooltip:
  • description:
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
master_of_subtlety_passive (_passive) 5.2 0.0 61.3sec 72.6sec 5.17% 5.18% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_master_of_subtlety_passive
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • master_of_subtlety_passive_1:5.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:
  • description:Attacks made while stealthed and for 6 seconds after breaking stealth cause an additional {$s1=10}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shadow_dance 5.3 0.0 62.0sec 62.0sec 17.32% 17.34% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_dance_1:17.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51713
  • name:Shadow Dance
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by {$s2=20}.
  • description:Enter the Shadow Dance for {$d=8 seconds}, allowing the use of abilities that ordinarily require Stealth, and reducing the Energy cost of Ambush by {$s2=20}.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
shadow_reflection 2.9 0.0 124.5sec 124.5sec 14.96% 14.98% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_shadow_reflection
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_reflection_1:14.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:152151
  • name:Shadow Reflection
  • tooltip:You have a Shadow Reflection, watching you and replicating your abilities used.
  • description:Summon a shadow of yourself on the target that will watch you and memorize your offensive ability usage for the next 8 sec. After this time, it will mimic the memorized abilities on its target over the next 8 sec.
  • max_stacks:0
  • duration:16.00
  • cooldown:120.00
  • default_chance:100.00%
slice_and_dice 2.3 6.6 123.9sec 36.2sec 99.76% 100.00% 156.2(156.2)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • slice_and_dice_1:99.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=40}%{$?s79152=false}[ and grant {$79152s1=8} Energy per $5171t2 sec][]. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
spirit_of_the_warlords 3.1 0.0 117.9sec 117.9sec 19.72% 19.73% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
stealth 5.2 0.0 61.3sec 72.6sec 5.17% 5.18% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:0.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stealth_1:5.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}%. ]?s13975[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%. ][]{$?s31223=false}[Attacks from Stealth and for {$31666d=6 seconds} after deal {$31223s1=10}% more damage. ][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:6.00
  • default_chance:100.00%
subterfuge 5.2 0.0 61.3sec 72.6sec 5.17% 5.18% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • subterfuge_1:5.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:Your Stealth breaks {$d=3 seconds} after dealing or receiving damage, rather than immediately.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
vanish 4.2 0.0 72.6sec 72.6sec 4.16% 4.17% 0.0(0.0)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • vanish_1:4.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_agility_flask

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_greater_draenic_agility_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:agility
  • amount:250.00

Stack Uptimes

  • greater_draenic_agility_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156064
  • name:Greater Draenic Agility Flask
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mîrai
ambush Energy 32.0 1452.8 45.4 45.4 643.4
backstab Energy 82.7 2895.1 35.0 35.0 303.0
eviscerate Energy 34.2 1198.7 35.0 35.0 1230.5
eviscerate Combo Points 34.2 171.2 5.0 5.0 8613.6
garrote Energy 1.0 45.0 45.0 45.0 279.5
rupture Energy 16.7 417.5 25.0 25.0 3242.4
rupture Combo Points 16.7 83.5 5.0 5.0 16211.8
slice_and_dice Energy 8.8 195.8 22.2 22.2 0.0
slice_and_dice Combo Points 8.8 44.2 5.0 5.0 0.0
Resource Gains Type Count Total Average Overflow
garrote Combo Points 1.00 1.00 (0.34%) 1.00 0.00 0.00%
ambush Combo Points 36.84 63.92 (21.42%) 1.73 0.00 0.00%
backstab Combo Points 82.72 82.72 (27.72%) 1.00 0.00 0.00%
energy_regen Energy 833.77 3443.48 (56.36%) 4.13 0.00 0.00%
external_healing Health 7.77 0.00 (0.00%) 0.00 72652.54 100.00%
energetic_recovery Energy 149.59 1196.70 (19.59%) 8.00 0.00 0.00%
honor_among_thieves Combo Points 135.58 135.58 (45.44%) 1.00 0.00 0.00%
premeditation Combo Points 8.40 15.13 (5.07%) 1.80 0.00 0.00%
relentless_strikes Energy 59.78 1469.50 (24.05%) 24.58 25.00 1.67%
Resource RPS-Gain RPS-Loss
Energy 20.30 20.62
Combo Points 0.99 0.99
Combat End Resource Mean Min Max
Energy 24.52 0.00 94.86
Combo Points 3.60 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.0%
shadow_reflection-Energy Cap 0.0%

Procs

Count Interval
Anticipation Charges (wasted) 0.7 79.1sec
Honor Among Thieves (Proxy action) 136.3 2.2sec

Statistics & Data Analysis

Fight Length
Sample Data Mîrai Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Mîrai Damage Per Second
Count 25000
Mean 26817.15
Minimum 24242.41
Maximum 30248.40
Spread ( max - min ) 6005.99
Range [ ( max - min ) / 2 * 100% ] 11.20%
Standard Deviation 814.3046
5th Percentile 25552.14
95th Percentile 28221.71
( 95th Percentile - 5th Percentile ) 2669.57
Mean Distribution
Standard Deviation 5.1501
95.00% Confidence Intervall ( 26807.06 - 26827.25 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3541
0.1 Scale Factor Error with Delta=300 5660
0.05 Scale Factor Error with Delta=300 22642
0.01 Scale Factor Error with Delta=300 566053
Distribution Chart
DPS(e)
Sample Data Mîrai Damage Per Second (Effective)
Count 25000
Mean 26817.15
Minimum 24242.41
Maximum 30248.40
Spread ( max - min ) 6005.99
Range [ ( max - min ) / 2 * 100% ] 11.20%
Damage
Sample Data Mîrai Damage
Count 25000
Mean 7609361.87
Minimum 5679190.38
Maximum 9625179.80
Spread ( max - min ) 3945989.42
Range [ ( max - min ) / 2 * 100% ] 25.93%
DTPS
Sample Data Mîrai Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mîrai Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Mîrai Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mîrai Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mîrai Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mîrai Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data MîraiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Mîrai Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_agility_flask
1 0.00 food,type=calamari_crepes
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=draenic_agility
5 0.00 stealth
6 0.00 slice_and_dice
7 0.00 honor_among_thieves,cooldown=2.2,cooldown_stddev=0.1
Proxy Honor Among Thieves action. Generates Combo Points at a mean rate of 2.2 seconds. Comment out to disable (and use the real Honor Among Thieves).
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|buff.shadow_dance.up&(trinket.proc.agi.react|trinket.proc.multistrike.react|trinket.stacking_proc.agi.react|trinket.stacking_proc.multistrike.react|buff.archmages_greater_incandescence_agi.react)
9 0.00 kick
A 2.88 use_item,slot=trinket2,if=buff.shadow_dance.up
B 2.88 shadow_reflection,if=buff.shadow_dance.up
C 0.00 blood_fury,if=buff.shadow_dance.up
D 0.00 berserking,if=buff.shadow_dance.up
E 0.00 arcane_torrent,if=energy<60&buff.shadow_dance.up
F 0.00 slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die&combo_points=((target.time_to_die-buff.slice_and_dice.remains)%6)+1
G 8.72 premeditation,if=combo_points<=4&!(buff.shadow_dance.up&energy>100&combo_points>1)&!buff.subterfuge.up|(buff.subterfuge.up&debuff.find_weakness.up)
H 0.00 pool_resource,for_next=1
I 1.00 garrote,if=!ticking&time<1
J 2.90 wait,sec=1,if=buff.subterfuge.remains>1.1&buff.subterfuge.remains<1.3&time>6
K 0.00 pool_resource,for_next=1
L 31.98 ambush,if=combo_points<5|(talent.anticipation.enabled&anticipation_charges<3)&(time<1.2|buff.shadow_dance.up|time>5)
M 0.00 pool_resource,for_next=1,extra_amount=50
N 5.29 shadow_dance,if=energy>=50&buff.stealth.down&buff.vanish.down&debuff.find_weakness.down|(buff.bloodlust.up&(dot.hemorrhage.ticking|dot.garrote.ticking|dot.rupture.ticking))
O 0.00 pool_resource,for_next=1,extra_amount=50
P 0.00 vanish,if=talent.shadow_focus.enabled&energy>=45&energy<=75&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
Q 0.00 pool_resource,for_next=1,extra_amount=90
R 4.19 vanish,if=talent.subterfuge.enabled&energy>=90&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
S 0.00 marked_for_death,if=combo_points=0
T 0.00 run_action_list,name=generator,if=talent.anticipation.enabled&anticipation_charges<4&buff.slice_and_dice.up&dot.rupture.remains>2&(buff.slice_and_dice.remains<6|dot.rupture.remains<4)
U 0.00 run_action_list,name=finisher,if=combo_points=5
V 0.00 run_action_list,name=generator,if=combo_points<4|(combo_points=4&cooldown.honor_among_thieves.remains>1&energy>70-energy.regen)|talent.anticipation.enabled
W 0.00 run_action_list,name=pool
actions.generator Combo point generators
# count action,conditions
X 0.00 run_action_list,name=pool,if=buff.master_of_subtlety.down&buff.shadow_dance.down&debuff.find_weakness.down&(energy+cooldown.shadow_dance.remains*energy.regen<80|energy+cooldown.vanish.remains*energy.regen<60)
Y 0.00 fan_of_knives,if=active_enemies>1
Z 0.00 shuriken_toss,if=energy<65&energy.regen<16
a 82.72 backstab
b 0.00 hemorrhage,if=position_front
c 0.00 run_action_list,name=pool
actions.finisher Combo point finishers
# count action,conditions
d 16.70 rupture,cycle_targets=1,if=(!ticking|remains<duration*0.3)&active_enemies<=3&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
e 7.83 slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die
f 0.00 death_from_above
g 0.00 crimson_tempest,if=(active_enemies>=3&dot.crimson_tempest_dot.ticks_remain<=2&combo_points=5)|active_enemies>=5&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
h 34.25 eviscerate,if=active_enemies<4|(active_enemies>3&dot.crimson_tempest_dot.ticks_remain>=2)&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
i 0.00 run_action_list,name=pool
actions.pool Resource pooling
# count action,conditions
j 1.16 preparation,if=!buff.vanish.up&cooldown.vanish.remains>60

Sample Sequence

0124567GILNABLdLLhLhLhaadaaahRGLLeajaadhaahRLJGLhahaadaNLLeLGhLLhhaadaaahaahaaadaaaaeaaadhaNABGL8LhLhLLdeaaahadRGLJLhahaahaadaaaeaaahNGLhLLdLhahaahaaadaaaaeaaadhaahaaahRGLdLeaaahNABLLhLhGLadhaahaaadaaaae

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points
Pre food Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points
Pre apply_poison Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points
Pre potion Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points draenic_agility_potion
Pre stealth Fluffy_Pillow 120.0/120: 100% energy | 5.0/5: 100% combo_points draenic_agility_potion
Pre slice_and_dice Fluffy_Pillow 120.0/120: 100% energy | 0.0/5: 0% combo_points slice_and_dice, draenic_agility_potion
Pre honor_among_thieves Fluffy_Pillow 120.0/120: 100% energy | 0.0/5: 0% combo_points slice_and_dice, draenic_agility_potion
0:00.000 premeditation Fluffy_Pillow 120.0/120: 100% energy | 0.0/5: 0% combo_points slice_and_dice, draenic_agility_potion
0:00.000 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/5: 40% combo_points slice_and_dice, draenic_agility_potion
0:01.004 ambush Fluffy_Pillow 89.4/120: 74% energy | 3.0/5: 60% combo_points bloodlust, subterfuge, slice_and_dice, mark_of_bleeding_hollow, draenic_agility_potion
0:02.008 shadow_dance Fluffy_Pillow 51.7/120: 43% energy | 5.0/5: 100% combo_points bloodlust, subterfuge, slice_and_dice, mark_of_bleeding_hollow, draenic_agility_potion
0:02.008 use_item_lucky_doublesided_coin Fluffy_Pillow 51.7/120: 43% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, subterfuge, slice_and_dice, mark_of_bleeding_hollow, draenic_agility_potion
0:02.008 shadow_reflection Fluffy_Pillow 51.7/120: 43% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, subterfuge, slice_and_dice, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:02.008 ambush Fluffy_Pillow 51.7/120: 43% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, subterfuge, slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:03.011 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:04.017 ambush Fluffy_Pillow 48.5/120: 40% energy | 3.0/5: 60% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:06.044 ambush Fluffy_Pillow 45.5/120: 38% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:07.049 Waiting 0.957 sec 19.9/120: 17% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:08.006 eviscerate Fluffy_Pillow 41.6/120: 35% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:09.010 ambush Fluffy_Pillow 46.0/120: 38% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:10.783 eviscerate Fluffy_Pillow 39.3/120: 33% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:11.789 ambush Fluffy_Pillow 43.7/120: 36% energy | 3.0/5: 60% combo_points bloodlust, shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:12.793 Waiting 0.700 sec 26.1/120: 22% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:13.493 eviscerate Fluffy_Pillow 36.1/120: 30% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:14.498 backstab Fluffy_Pillow 48.5/120: 40% energy | 1.0/5: 20% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:15.503 Waiting 0.500 sec 27.9/120: 23% energy | 3.0/5: 60% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:16.003 backstab Fluffy_Pillow 43.0/120: 36% energy | 3.0/5: 60% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:17.009 Waiting 0.479 sec 22.4/120: 19% energy | 4.0/5: 80% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:17.488 rupture Fluffy_Pillow 29.3/120: 24% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:18.492 backstab Fluffy_Pillow 51.7/120: 43% energy | 0.0/5: 0% combo_points bloodlust, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:19.496 Waiting 0.300 sec 31.0/120: 26% energy | 1.0/5: 20% combo_points bloodlust, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:19.796 backstab Fluffy_Pillow 35.3/120: 29% energy | 2.0/5: 40% combo_points bloodlust, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
0:20.802 Waiting 0.859 sec 22.7/120: 19% energy | 3.0/5: 60% combo_points bloodlust, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
0:21.661 backstab Fluffy_Pillow 35.0/120: 29% energy | 3.0/5: 60% combo_points bloodlust, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
0:22.665 Waiting 0.882 sec 22.4/120: 19% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, spirit_of_the_warlords
0:23.547 eviscerate Fluffy_Pillow 35.0/120: 29% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, spirit_of_the_warlords
0:27.111 vanish Fluffy_Pillow 92.0/120: 77% energy | 2.0/5: 40% combo_points bloodlust, slice_and_dice, mark_of_bleeding_hollow
0:27.111 premeditation Fluffy_Pillow 92.0/120: 77% energy | 2.0/5: 40% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, slice_and_dice, mark_of_bleeding_hollow
0:27.111 ambush Fluffy_Pillow 92.0/120: 77% energy | 4.0/5: 80% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, slice_and_dice, mark_of_bleeding_hollow
0:28.626 ambush Fluffy_Pillow 61.7/120: 51% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation(2), mark_of_bleeding_hollow
0:29.631 Waiting 0.623 sec 16.1/120: 13% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation(4), mark_of_bleeding_hollow
0:30.254 slice_and_dice Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(4), mark_of_bleeding_hollow
0:31.258 backstab Fluffy_Pillow 47.4/120: 39% energy | 1.0/5: 20% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(4), mark_of_bleeding_hollow
0:32.262 preparation Fluffy_Pillow 34.7/120: 29% energy | 2.0/5: 40% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(4), mark_of_bleeding_hollow
0:33.266 backstab Fluffy_Pillow 49.1/120: 41% energy | 3.0/5: 60% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(4), mark_of_bleeding_hollow
0:34.272 backstab Fluffy_Pillow 36.5/120: 30% energy | 4.0/5: 80% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(4), mark_of_bleeding_hollow
0:35.276 Waiting 0.737 sec 15.9/120: 13% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(4), mark_of_bleeding_hollow
0:36.013 rupture Fluffy_Pillow 34.4/120: 29% energy | 5.0/5: 100% combo_points bloodlust, master_of_subtlety, slice_and_dice, anticipation(5), mark_of_bleeding_hollow
0:37.018 eviscerate Fluffy_Pillow 48.8/120: 41% energy | 5.0/5: 100% combo_points bloodlust, slice_and_dice, mark_of_bleeding_hollow
0:38.022 backstab Fluffy_Pillow 61.2/120: 51% energy | 1.0/5: 20% combo_points bloodlust, slice_and_dice, mark_of_bleeding_hollow
0:42.095 backstab Fluffy_Pillow 96.2/120: 80% energy | 4.0/5: 80% combo_points slice_and_dice
0:43.098 eviscerate Fluffy_Pillow 72.3/120: 60% energy | 5.0/5: 100% combo_points slice_and_dice
0:45.126 vanish Fluffy_Pillow 92.6/120: 77% energy | 1.0/5: 20% combo_points slice_and_dice
0:45.126 ambush Fluffy_Pillow 92.6/120: 77% energy | 1.0/5: 20% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice
0:46.897 wait Fluffy_Pillow 60.1/120: 50% energy | 4.0/5: 80% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice
0:47.897 premeditation Fluffy_Pillow 71.1/120: 59% energy | 4.0/5: 80% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice
0:47.897 ambush Fluffy_Pillow 71.1/120: 59% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice
0:48.901 Waiting 0.500 sec 30.2/120: 25% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(3)
0:49.401 eviscerate Fluffy_Pillow 35.7/120: 30% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(3)
0:50.406 backstab Fluffy_Pillow 44.7/120: 37% energy | 3.0/5: 60% combo_points master_of_subtlety, slice_and_dice
0:51.410 Waiting 0.682 sec 20.8/120: 17% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice
0:52.092 eviscerate Fluffy_Pillow 36.3/120: 30% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice
0:53.096 backstab Fluffy_Pillow 37.4/120: 31% energy | 1.0/5: 20% combo_points master_of_subtlety, slice_and_dice
0:54.102 Waiting 1.324 sec 21.4/120: 18% energy | 2.0/5: 40% combo_points master_of_subtlety, slice_and_dice
0:55.426 backstab Fluffy_Pillow 36.0/120: 30% energy | 3.0/5: 60% combo_points slice_and_dice
0:56.431 Waiting 1.147 sec 20.1/120: 17% energy | 4.0/5: 80% combo_points slice_and_dice
0:57.578 rupture Fluffy_Pillow 32.7/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice
0:58.581 backstab Fluffy_Pillow 51.7/120: 43% energy | 0.0/5: 0% combo_points slice_and_dice
0:59.584 Waiting 2.500 sec 27.8/120: 23% energy | 1.0/5: 20% combo_points slice_and_dice
1:02.084 shadow_dance Fluffy_Pillow 71.3/120: 59% energy | 3.0/5: 60% combo_points slice_and_dice
1:02.084 ambush Fluffy_Pillow 71.3/120: 59% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice
1:03.088 ambush Fluffy_Pillow 42.4/120: 35% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice
1:04.348 Waiting 0.100 sec 24.2/120: 20% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3), mark_of_bleeding_hollow
1:04.448 slice_and_dice Fluffy_Pillow 25.3/120: 21% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3), mark_of_bleeding_hollow
1:05.962 ambush Fluffy_Pillow 42.0/120: 35% energy | 0.0/5: 0% combo_points shadow_dance, slice_and_dice, anticipation(3), mark_of_bleeding_hollow
1:07.986 premeditation Fluffy_Pillow 32.3/120: 27% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, anticipation(3), mark_of_bleeding_hollow
1:07.986 Waiting 0.100 sec 32.3/120: 27% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3), mark_of_bleeding_hollow
1:08.086 eviscerate Fluffy_Pillow 41.4/120: 34% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3), mark_of_bleeding_hollow
1:09.091 ambush Fluffy_Pillow 42.4/120: 35% energy | 4.0/5: 80% combo_points shadow_dance, slice_and_dice, mark_of_bleeding_hollow
1:11.882 ambush Fluffy_Pillow 41.2/120: 34% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(2), mark_of_bleeding_hollow
1:12.886 Waiting 1.133 sec 20.2/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(4), mark_of_bleeding_hollow
1:14.019 eviscerate Fluffy_Pillow 40.7/120: 34% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5), mark_of_bleeding_hollow
1:15.024 eviscerate Fluffy_Pillow 41.8/120: 35% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
1:16.030 backstab Fluffy_Pillow 50.8/120: 42% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_bleeding_hollow
1:17.035 Waiting 0.800 sec 26.9/120: 22% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
1:17.835 backstab Fluffy_Pillow 35.7/120: 30% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_bleeding_hollow
1:18.839 Waiting 0.575 sec 19.8/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow
1:19.414 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
1:20.419 backstab Fluffy_Pillow 45.2/120: 38% energy | 0.0/5: 0% combo_points slice_and_dice, mark_of_bleeding_hollow
1:21.423 Waiting 0.644 sec 21.2/120: 18% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_bleeding_hollow
1:22.067 backstab Fluffy_Pillow 36.3/120: 30% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
1:23.072 Waiting 1.347 sec 12.4/120: 10% energy | 3.0/5: 60% combo_points slice_and_dice
1:24.419 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
1:25.423 Waiting 1.449 sec 11.2/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
1:26.872 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, mark_of_bleeding_hollow
1:27.877 backstab Fluffy_Pillow 36.3/120: 30% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_bleeding_hollow
1:28.882 Waiting 1.124 sec 20.3/120: 17% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_bleeding_hollow
1:30.006 backstab Fluffy_Pillow 40.7/120: 34% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_bleeding_hollow
1:31.010 Waiting 1.048 sec 16.8/120: 14% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
1:32.058 eviscerate Fluffy_Pillow 36.3/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
1:33.061 backstab Fluffy_Pillow 37.3/120: 31% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_bleeding_hollow
1:34.063 Waiting 1.329 sec 21.4/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
1:35.392 backstab Fluffy_Pillow 36.0/120: 30% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_bleeding_hollow
1:36.397 Waiting 1.448 sec 20.1/120: 17% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow
1:37.845 backstab Fluffy_Pillow 36.0/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice
1:38.848 Waiting 0.549 sec 20.0/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:39.397 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:40.400 backstab Fluffy_Pillow 45.1/120: 38% energy | 2.0/5: 40% combo_points slice_and_dice
1:41.404 Waiting 0.646 sec 21.2/120: 18% energy | 3.0/5: 60% combo_points slice_and_dice
1:42.050 backstab Fluffy_Pillow 36.3/120: 30% energy | 4.0/5: 80% combo_points slice_and_dice
1:43.054 Waiting 1.348 sec 12.4/120: 10% energy | 5.0/5: 100% combo_points slice_and_dice
1:44.402 backstab Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
1:45.406 Waiting 1.449 sec 11.2/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
1:46.855 backstab Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(3)
1:47.858 Waiting 1.249 sec 11.2/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(4)
1:49.107 slice_and_dice Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points anticipation(5)
1:50.111 backstab Fluffy_Pillow 44.0/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice, anticipation(5)
1:51.114 Waiting 0.700 sec 28.1/120: 23% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation(5)
1:51.814 backstab Fluffy_Pillow 35.8/120: 30% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation(5)
1:52.820 Waiting 1.392 sec 11.9/120: 10% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation(5)
1:54.212 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation(5)
1:55.218 Waiting 0.620 sec 19.3/120: 16% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
1:55.838 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
1:56.841 eviscerate Fluffy_Pillow 37.1/120: 31% energy | 5.0/5: 100% combo_points slice_and_dice
1:57.846 backstab Fluffy_Pillow 46.2/120: 39% energy | 1.0/5: 20% combo_points slice_and_dice
1:58.848 Waiting 3.251 sec 22.2/120: 19% energy | 2.0/5: 40% combo_points slice_and_dice
2:02.099 shadow_dance Fluffy_Pillow 74.0/120: 62% energy | 4.0/5: 80% combo_points slice_and_dice, spirit_of_the_warlords
2:02.099 use_item_lucky_doublesided_coin Fluffy_Pillow 74.0/120: 62% energy | 4.0/5: 80% combo_points shadow_dance, slice_and_dice, spirit_of_the_warlords
2:02.099 shadow_reflection Fluffy_Pillow 74.0/120: 62% energy | 4.0/5: 80% combo_points shadow_dance, slice_and_dice, spirit_of_the_warlords, lucky_flip
2:02.099 premeditation Fluffy_Pillow 74.0/120: 62% energy | 4.0/5: 80% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, lucky_flip
2:02.099 ambush Fluffy_Pillow 74.0/120: 62% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, lucky_flip
2:03.101 potion Fluffy_Pillow 45.1/120: 38% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(2), spirit_of_the_warlords, lucky_flip
2:03.101 ambush Fluffy_Pillow 45.1/120: 38% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(2), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:04.104 Waiting 1.000 sec 24.1/120: 20% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(5), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:05.104 eviscerate Fluffy_Pillow 35.1/120: 29% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(5), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:06.109 ambush Fluffy_Pillow 44.2/120: 37% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:07.114 Waiting 1.160 sec 23.2/120: 19% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), spirit_of_the_warlords, draenic_agility_potion, lucky_flip
2:08.274 eviscerate Fluffy_Pillow 36.0/120: 30% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:09.277 ambush Fluffy_Pillow 45.0/120: 38% energy | 4.0/5: 80% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:11.816 ambush Fluffy_Pillow 41.0/120: 34% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(2), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:12.821 Waiting 1.174 sec 12.1/120: 10% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation(5), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:13.995 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation(5), spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:15.000 slice_and_dice Fluffy_Pillow 44.1/120: 37% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:16.006 backstab Fluffy_Pillow 63.1/120: 53% energy | 0.0/5: 0% combo_points slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:17.009 backstab Fluffy_Pillow 39.2/120: 33% energy | 2.0/5: 40% combo_points slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:18.014 Waiting 1.160 sec 23.2/120: 19% energy | 3.0/5: 60% combo_points slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:19.174 backstab Fluffy_Pillow 44.0/120: 37% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:20.178 Waiting 0.948 sec 20.1/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:21.126 eviscerate Fluffy_Pillow 38.5/120: 32% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, mark_of_bleeding_hollow, draenic_agility_potion, lucky_flip
2:25.447 backstab Fluffy_Pillow 92.1/120: 77% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow, draenic_agility_potion
2:26.451 rupture Fluffy_Pillow 68.1/120: 57% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow, draenic_agility_potion
2:27.966 vanish Fluffy_Pillow 92.8/120: 77% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_bleeding_hollow, draenic_agility_potion
2:27.966 premeditation Fluffy_Pillow 92.8/120: 77% energy | 1.0/5: 20% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice, mark_of_bleeding_hollow, draenic_agility_potion
2:27.966 ambush Fluffy_Pillow 92.8/120: 77% energy | 3.0/5: 60% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice, mark_of_bleeding_hollow, draenic_agility_potion
2:29.738 wait Fluffy_Pillow 60.3/120: 50% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, mark_of_bleeding_hollow
2:30.738 ambush Fluffy_Pillow 71.3/120: 59% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation, mark_of_bleeding_hollow
2:31.741 Waiting 0.500 sec 30.4/120: 25% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(3), mark_of_bleeding_hollow
2:32.241 eviscerate Fluffy_Pillow 35.9/120: 30% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation(4), mark_of_bleeding_hollow
2:33.243 backstab Fluffy_Pillow 44.9/120: 37% energy | 4.0/5: 80% combo_points master_of_subtlety, slice_and_dice
2:34.249 Waiting 0.865 sec 21.0/120: 17% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation
2:35.114 eviscerate Fluffy_Pillow 38.5/120: 32% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation
2:36.119 backstab Fluffy_Pillow 39.6/120: 33% energy | 1.0/5: 20% combo_points master_of_subtlety, slice_and_dice
2:37.126 Waiting 1.123 sec 23.6/120: 20% energy | 3.0/5: 60% combo_points slice_and_dice
2:38.249 backstab Fluffy_Pillow 36.0/120: 30% energy | 3.0/5: 60% combo_points slice_and_dice
2:39.253 Waiting 1.448 sec 20.1/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice
2:40.701 eviscerate Fluffy_Pillow 36.0/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
2:41.707 backstab Fluffy_Pillow 45.1/120: 38% energy | 1.0/5: 20% combo_points slice_and_dice
2:42.712 Waiting 0.550 sec 21.1/120: 18% energy | 3.0/5: 60% combo_points slice_and_dice
2:43.262 backstab Fluffy_Pillow 35.2/120: 29% energy | 3.0/5: 60% combo_points slice_and_dice
2:44.265 Waiting 1.249 sec 11.2/120: 9% energy | 4.0/5: 80% combo_points slice_and_dice
2:45.514 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice
2:46.518 backstab Fluffy_Pillow 44.0/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice
2:47.522 Waiting 0.700 sec 28.1/120: 23% energy | 2.0/5: 40% combo_points slice_and_dice
2:48.222 backstab Fluffy_Pillow 35.8/120: 30% energy | 2.0/5: 40% combo_points slice_and_dice
2:49.226 Waiting 1.467 sec 19.9/120: 17% energy | 3.0/5: 60% combo_points slice_and_dice
2:50.693 backstab Fluffy_Pillow 36.0/120: 30% energy | 4.0/5: 80% combo_points slice_and_dice
2:51.698 Waiting 0.547 sec 20.1/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice
2:52.245 slice_and_dice Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
2:53.249 backstab Fluffy_Pillow 45.1/120: 38% energy | 0.0/5: 0% combo_points slice_and_dice, anticipation
2:54.254 Waiting 0.944 sec 21.2/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation
2:55.198 backstab Fluffy_Pillow 39.6/120: 33% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation
2:56.201 Waiting 1.049 sec 15.6/120: 13% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation
2:57.250 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation
2:58.254 Waiting 1.449 sec 11.2/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
2:59.703 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
3:00.707 Waiting 1.400 sec 36.3/120: 30% energy | 3.0/5: 60% combo_points slice_and_dice
3:02.107 shadow_dance Fluffy_Pillow 59.7/120: 50% energy | 3.0/5: 60% combo_points slice_and_dice
3:02.107 premeditation Fluffy_Pillow 59.7/120: 50% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice
3:02.107 ambush Fluffy_Pillow 59.7/120: 50% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice
3:03.111 eviscerate Fluffy_Pillow 38.7/120: 32% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3)
3:04.372 ambush Fluffy_Pillow 42.6/120: 36% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice
3:07.168 ambush Fluffy_Pillow 49.4/120: 41% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(2), mark_of_bleeding_hollow
3:08.173 Waiting 0.513 sec 20.4/120: 17% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(4), mark_of_bleeding_hollow
3:08.686 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(4), mark_of_bleeding_hollow
3:09.689 ambush Fluffy_Pillow 45.1/120: 38% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, mark_of_bleeding_hollow
3:11.460 Waiting 0.300 sec 32.6/120: 27% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3), mark_of_bleeding_hollow
3:11.760 eviscerate Fluffy_Pillow 35.9/120: 30% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, anticipation(3), mark_of_bleeding_hollow
3:12.764 backstab Fluffy_Pillow 37.0/120: 31% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_bleeding_hollow
3:13.767 Waiting 1.360 sec 21.0/120: 18% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
3:15.127 eviscerate Fluffy_Pillow 44.0/120: 37% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow
3:16.132 backstab Fluffy_Pillow 45.1/120: 38% energy | 1.0/5: 20% combo_points slice_and_dice, mark_of_bleeding_hollow
3:17.136 Waiting 0.600 sec 29.1/120: 24% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
3:17.736 backstab Fluffy_Pillow 35.7/120: 30% energy | 2.0/5: 40% combo_points slice_and_dice, mark_of_bleeding_hollow
3:18.740 Waiting 1.400 sec 11.8/120: 10% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow
3:20.140 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice
3:21.146 backstab Fluffy_Pillow 44.3/120: 37% energy | 0.0/5: 0% combo_points slice_and_dice
3:22.151 Waiting 1.023 sec 20.3/120: 17% energy | 1.0/5: 20% combo_points slice_and_dice
3:23.174 backstab Fluffy_Pillow 39.6/120: 33% energy | 2.0/5: 40% combo_points slice_and_dice
3:24.180 Waiting 1.047 sec 15.7/120: 13% energy | 3.0/5: 60% combo_points slice_and_dice
3:25.227 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice
3:26.232 Waiting 1.247 sec 11.3/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice
3:27.479 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:28.481 backstab Fluffy_Pillow 44.0/120: 37% energy | 1.0/5: 20% combo_points slice_and_dice
3:29.485 Waiting 0.700 sec 28.1/120: 23% energy | 3.0/5: 60% combo_points slice_and_dice
3:30.185 backstab Fluffy_Pillow 35.8/120: 30% energy | 3.0/5: 60% combo_points slice_and_dice
3:31.189 Waiting 1.468 sec 19.8/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice
3:32.657 backstab Fluffy_Pillow 36.0/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice
3:33.662 Waiting 1.448 sec 20.1/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
3:35.110 backstab Fluffy_Pillow 44.0/120: 37% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
3:36.114 Waiting 0.548 sec 20.1/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(4)
3:36.662 slice_and_dice Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(4)
3:37.668 backstab Fluffy_Pillow 45.2/120: 38% energy | 0.0/5: 0% combo_points slice_and_dice, anticipation(4)
3:38.673 Waiting 0.542 sec 21.2/120: 18% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation(4)
3:39.215 backstab Fluffy_Pillow 35.2/120: 29% energy | 2.0/5: 40% combo_points slice_and_dice, anticipation(4)
3:40.219 Waiting 1.448 sec 11.3/120: 9% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation(4)
3:41.667 backstab Fluffy_Pillow 35.2/120: 29% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation(4)
3:42.671 Waiting 1.249 sec 11.2/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
3:43.920 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(5)
3:44.924 eviscerate Fluffy_Pillow 44.1/120: 37% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
3:45.928 backstab Fluffy_Pillow 53.1/120: 44% energy | 1.0/5: 20% combo_points slice_and_dice
3:46.933 Waiting 0.200 sec 29.2/120: 24% energy | 3.0/5: 60% combo_points slice_and_dice
3:47.133 backstab Fluffy_Pillow 39.4/120: 33% energy | 3.0/5: 60% combo_points slice_and_dice
3:48.140 Waiting 1.066 sec 15.5/120: 13% energy | 4.0/5: 80% combo_points slice_and_dice
3:49.206 eviscerate Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice
3:50.208 backstab Fluffy_Pillow 36.2/120: 30% energy | 0.0/5: 0% combo_points slice_and_dice
3:51.215 Waiting 1.426 sec 20.3/120: 17% energy | 2.0/5: 40% combo_points slice_and_dice
3:52.641 backstab Fluffy_Pillow 36.0/120: 30% energy | 2.0/5: 40% combo_points slice_and_dice
3:53.646 Waiting 1.447 sec 20.1/120: 17% energy | 4.0/5: 80% combo_points slice_and_dice
3:55.093 backstab Fluffy_Pillow 36.0/120: 30% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow
3:56.098 Waiting 1.047 sec 20.1/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, mark_of_bleeding_hollow
3:57.145 eviscerate Fluffy_Pillow 39.6/120: 33% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation, mark_of_bleeding_hollow
4:01.215 vanish Fluffy_Pillow 90.4/120: 75% energy | 3.0/5: 60% combo_points slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow
4:01.215 premeditation Fluffy_Pillow 90.4/120: 75% energy | 3.0/5: 60% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow
4:01.215 ambush Fluffy_Pillow 90.4/120: 75% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow
4:02.475 rupture Fluffy_Pillow 44.3/120: 37% energy | 5.0/5: 100% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, anticipation(3), spirit_of_the_warlords, mark_of_bleeding_hollow
4:03.481 ambush Fluffy_Pillow 63.3/120: 53% energy | 3.0/5: 60% combo_points master_of_subtlety_passive, stealth, vanish, subterfuge, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow
4:04.485 Waiting 0.962 sec 14.4/120: 12% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow
4:05.447 slice_and_dice Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points master_of_subtlety, slice_and_dice, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow
4:06.451 backstab Fluffy_Pillow 44.0/120: 37% energy | 0.0/5: 0% combo_points master_of_subtlety, slice_and_dice, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow
4:07.456 Waiting 0.700 sec 28.1/120: 23% energy | 2.0/5: 40% combo_points master_of_subtlety, slice_and_dice, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow
4:08.156 backstab Fluffy_Pillow 35.8/120: 30% energy | 2.0/5: 40% combo_points master_of_subtlety, slice_and_dice, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow
4:09.162 Waiting 1.463 sec 19.9/120: 17% energy | 4.0/5: 80% combo_points master_of_subtlety, slice_and_dice, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow
4:10.625 backstab Fluffy_Pillow 36.0/120: 30% energy | 4.0/5: 80% combo_points slice_and_dice, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow
4:11.629 Waiting 1.449 sec 20.1/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2), spirit_of_the_warlords, mark_of_bleeding_hollow
4:13.078 eviscerate Fluffy_Pillow 36.0/120: 30% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2), spirit_of_the_warlords, mark_of_bleeding_hollow
4:14.596 shadow_dance Fluffy_Pillow 50.7/120: 42% energy | 3.0/5: 60% combo_points slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow
4:14.596 use_item_lucky_doublesided_coin Fluffy_Pillow 50.7/120: 42% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow
4:14.596 shadow_reflection Fluffy_Pillow 50.7/120: 42% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:14.596 ambush Fluffy_Pillow 50.7/120: 42% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:16.625 ambush Fluffy_Pillow 41.1/120: 34% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation, spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:17.628 Waiting 1.445 sec 20.1/120: 17% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:19.073 eviscerate Fluffy_Pillow 36.0/120: 30% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(4), spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:20.077 ambush Fluffy_Pillow 45.1/120: 38% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, spirit_of_the_warlords, mark_of_bleeding_hollow, lucky_flip
4:22.106 eviscerate Fluffy_Pillow 35.4/120: 29% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), mark_of_bleeding_hollow, lucky_flip
4:23.112 premeditation Fluffy_Pillow 44.5/120: 37% energy | 3.0/5: 60% combo_points shadow_dance, slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, lucky_flip
4:23.112 ambush Fluffy_Pillow 44.5/120: 37% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, lucky_flip
4:24.370 Waiting 0.806 sec 18.3/120: 15% energy | 5.0/5: 100% combo_points shadow_dance, slice_and_dice, shadow_reflection, anticipation(3), mark_of_bleeding_hollow, lucky_flip
4:25.176 backstab Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation(3), mark_of_bleeding_hollow, lucky_flip
4:26.180 Waiting 1.249 sec 11.2/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation(4), mark_of_bleeding_hollow, lucky_flip
4:27.429 rupture Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation(5), mark_of_bleeding_hollow, lucky_flip
4:28.432 eviscerate Fluffy_Pillow 44.0/120: 37% energy | 5.0/5: 100% combo_points slice_and_dice, shadow_reflection, anticipation, mark_of_bleeding_hollow, lucky_flip
4:29.438 backstab Fluffy_Pillow 53.1/120: 44% energy | 1.0/5: 20% combo_points slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, lucky_flip
4:30.443 Waiting 0.600 sec 29.2/120: 24% energy | 2.0/5: 40% combo_points slice_and_dice, shadow_reflection, mark_of_bleeding_hollow, lucky_flip
4:31.043 backstab Fluffy_Pillow 35.8/120: 30% energy | 3.0/5: 60% combo_points slice_and_dice, mark_of_bleeding_hollow, lucky_flip
4:32.048 Waiting 1.067 sec 19.9/120: 17% energy | 4.0/5: 80% combo_points slice_and_dice, mark_of_bleeding_hollow, lucky_flip
4:33.115 eviscerate Fluffy_Pillow 39.6/120: 33% energy | 5.0/5: 100% combo_points slice_and_dice, mark_of_bleeding_hollow, lucky_flip
4:34.119 backstab Fluffy_Pillow 40.7/120: 34% energy | 0.0/5: 0% combo_points slice_and_dice, lucky_flip
4:35.125 Waiting 1.000 sec 24.7/120: 21% energy | 2.0/5: 40% combo_points slice_and_dice
4:36.125 backstab Fluffy_Pillow 35.7/120: 30% energy | 2.0/5: 40% combo_points slice_and_dice
4:37.130 Waiting 1.472 sec 19.8/120: 16% energy | 4.0/5: 80% combo_points slice_and_dice
4:38.602 backstab Fluffy_Pillow 36.0/120: 30% energy | 4.0/5: 80% combo_points slice_and_dice
4:39.606 Waiting 0.548 sec 20.1/120: 17% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
4:40.154 rupture Fluffy_Pillow 26.1/120: 22% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation
4:41.157 backstab Fluffy_Pillow 45.1/120: 38% energy | 1.0/5: 20% combo_points slice_and_dice
4:42.161 Waiting 0.946 sec 21.2/120: 18% energy | 3.0/5: 60% combo_points slice_and_dice
4:43.107 backstab Fluffy_Pillow 39.6/120: 33% energy | 3.0/5: 60% combo_points slice_and_dice
4:44.113 Waiting 1.046 sec 15.7/120: 13% energy | 5.0/5: 100% combo_points slice_and_dice
4:45.159 backstab Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice
4:46.163 Waiting 1.449 sec 11.2/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
4:47.612 backstab Fluffy_Pillow 35.2/120: 29% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(2)
4:48.618 Waiting 1.246 sec 11.3/120: 9% energy | 5.0/5: 100% combo_points slice_and_dice, anticipation(4)
4:49.864 slice_and_dice Fluffy_Pillow 33.0/120: 27% energy | 5.0/5: 100% combo_points anticipation(4)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 1271 1211 1211
Agility 4884 4350 3667 (1615)
Stamina 4530 4119 4119
Intellect 745 710 710
Spirit 532 532 532
Health 271800 247140 0
Energy 120 120 0
Combo Points 5 5 0
Crit 24.79% 19.79% 527
Haste 10.09% 4.85% 485
Multistrike 20.27% 13.68% 903
Damage / Heal Versatility 6.49% 3.49% 454
Attack Power 5372 4350 0
Mastery 64.59% 49.59% 938
Armor 950 950 950

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Cloak and Dagger Shadowstep Burst of Speed
75 Prey on the Weak Internal Bleeding Dirty Tricks
90 Shuriken Toss Marked for Death Anticipation
100 Venom Rush Shadow Reflection Death from Above

Profile

rogue="Mîrai"
origin="http://eu.battle.net/wow/en/character/forscherliga/Mîrai/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/98/74316130-avatar.jpg"
level=100
race=dwarf
role=attack
position=back
professions=jewelcrafting=700/leatherworking=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#cb!1101021
glyphs=hemorrhaging_veins/cloak_of_shadows/energy/poisons/safe_fall
spec=subtlety

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_agility_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/apply_poison,lethal=deadly
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_agility
actions.precombat+=/stealth
actions.precombat+=/slice_and_dice
# Proxy Honor Among Thieves action. Generates Combo Points at a mean rate of 2.2 seconds. Comment out to disable (and use the real Honor Among Thieves).
actions.precombat+=/honor_among_thieves,cooldown=2.2,cooldown_stddev=0.1

# Executed every time the actor is available.

actions=potion,name=draenic_agility,if=buff.bloodlust.react|target.time_to_die<40|buff.shadow_dance.up&(trinket.proc.agi.react|trinket.proc.multistrike.react|trinket.stacking_proc.agi.react|trinket.stacking_proc.multistrike.react|buff.archmages_greater_incandescence_agi.react)
actions+=/kick
actions+=/use_item,slot=trinket2,if=buff.shadow_dance.up
actions+=/shadow_reflection,if=buff.shadow_dance.up
actions+=/blood_fury,if=buff.shadow_dance.up
actions+=/berserking,if=buff.shadow_dance.up
actions+=/arcane_torrent,if=energy<60&buff.shadow_dance.up
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die&combo_points=((target.time_to_die-buff.slice_and_dice.remains)%6)+1
actions+=/premeditation,if=combo_points<=4&!(buff.shadow_dance.up&energy>100&combo_points>1)&!buff.subterfuge.up|(buff.subterfuge.up&debuff.find_weakness.up)
actions+=/pool_resource,for_next=1
actions+=/garrote,if=!ticking&time<1
actions+=/wait,sec=1,if=buff.subterfuge.remains>1.1&buff.subterfuge.remains<1.3&time>6
actions+=/pool_resource,for_next=1
actions+=/ambush,if=combo_points<5|(talent.anticipation.enabled&anticipation_charges<3)&(time<1.2|buff.shadow_dance.up|time>5)
actions+=/pool_resource,for_next=1,extra_amount=50
actions+=/shadow_dance,if=energy>=50&buff.stealth.down&buff.vanish.down&debuff.find_weakness.down|(buff.bloodlust.up&(dot.hemorrhage.ticking|dot.garrote.ticking|dot.rupture.ticking))
actions+=/pool_resource,for_next=1,extra_amount=50
actions+=/vanish,if=talent.shadow_focus.enabled&energy>=45&energy<=75&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
actions+=/pool_resource,for_next=1,extra_amount=90
actions+=/vanish,if=talent.subterfuge.enabled&energy>=90&combo_points<=3&buff.shadow_dance.down&buff.master_of_subtlety.down&debuff.find_weakness.down
actions+=/marked_for_death,if=combo_points=0
actions+=/run_action_list,name=generator,if=talent.anticipation.enabled&anticipation_charges<4&buff.slice_and_dice.up&dot.rupture.remains>2&(buff.slice_and_dice.remains<6|dot.rupture.remains<4)
actions+=/run_action_list,name=finisher,if=combo_points=5
actions+=/run_action_list,name=generator,if=combo_points<4|(combo_points=4&cooldown.honor_among_thieves.remains>1&energy>70-energy.regen)|talent.anticipation.enabled
actions+=/run_action_list,name=pool

# Combo point generators

actions.generator=run_action_list,name=pool,if=buff.master_of_subtlety.down&buff.shadow_dance.down&debuff.find_weakness.down&(energy+cooldown.shadow_dance.remains*energy.regen<80|energy+cooldown.vanish.remains*energy.regen<60)
actions.generator+=/fan_of_knives,if=active_enemies>1
actions.generator+=/shuriken_toss,if=energy<65&energy.regen<16
actions.generator+=/backstab
actions.generator+=/hemorrhage,if=position_front
actions.generator+=/run_action_list,name=pool

# Combo point finishers

actions.finisher=rupture,cycle_targets=1,if=(!ticking|remains<duration*0.3)&active_enemies<=3&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
actions.finisher+=/slice_and_dice,if=buff.slice_and_dice.remains<10.8&buff.slice_and_dice.remains<target.time_to_die
actions.finisher+=/death_from_above
actions.finisher+=/crimson_tempest,if=(active_enemies>=3&dot.crimson_tempest_dot.ticks_remain<=2&combo_points=5)|active_enemies>=5&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
actions.finisher+=/eviscerate,if=active_enemies<4|(active_enemies>3&dot.crimson_tempest_dot.ticks_remain>=2)&(cooldown.death_from_above.remains>0|!talent.death_from_above.enabled)
actions.finisher+=/run_action_list,name=pool

# Resource pooling

actions.pool=preparation,if=!buff.vanish.up&cooldown.vanish.remains>60

head=runeenscribed_hood,id=113845
neck=shifting_taladite_pendant,id=115800,bonus_id=190/527/540,enchant=75mult
shoulders=studded_frostboar_leather_spaulders,id=118890
back=cloak_of_creeping_necrosis,id=113657,bonus_id=566,enchant=gift_of_multistrike
chest=chestguard_of_determined_resolve,id=114497,bonus_id=52
wrists=exceptional_crystalhide_bracers,id=116962
hands=throatripper_gauntlets,id=113602,bonus_id=561/564/566,gems=50mult
waist=waistgirdle_of_the_mountain,id=118886
legs=nether_blast_leggings,id=113856
feet=sandals_of_mycoid_musing,id=113664,bonus_id=566
finger1=timeless_solium_band_of_the_assassin,id=118297,enchant=50mult
finger2=shifting_taladite_ring,id=115796,bonus_id=181/527/540,enchant=50mult
trinket1=skull_of_war,id=112318,bonus_id=525/529
trinket2=lucky_doublesided_coin,id=118876
main_hand=koraghs_boot_knife,id=113836,enchant=mark_of_bleeding_hollow
off_hand=felshanker,id=118738,bonus_id=524,enchant=mark_of_the_shattered_hand

# Gear Summary
# gear_agility=2323
# gear_stamina=3228
# gear_crit_rating=527
# gear_haste_rating=485
# gear_mastery_rating=938
# gear_armor=950
# gear_multistrike_rating=860
# gear_versatility_rating=454

Shaerlyn

Shaerlyn : 27337 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
27337.4 27337.4 10.8 / 0.040% 3364.9 / 12.3% 67.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
381.0 381.0 Mana 0.00% 43.2 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Shaerlyn/advanced
Talents
  • 15: Astral Shift
  • 30: Windwalk Totem
  • 45: Totemic Projection
  • 60: Elemental Mastery
  • 75: Ancestral Guidance
  • 90: Unleashed Fury
  • 100: Elemental Fusion
  • Talent Calculator
Glyphs
  • Glyph of Chain Lightning
  • Glyph of Capacitor Totem
  • Glyph of Spiritwalker's Focus
  • Glyph of the Lakestrider
  • Glyph of Astral Recall
  • Glyph of Ghostly Speed
Professions
  • jewelcrafting: 710
  • enchanting: 700

Charts

http://7.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Shaerlyn+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x150&chd=t:49939|38085|36667|12659&chds=0,99878&chco=ABD473,C41F3B,C41F3B,ABD473&chm=t++49939++earth_shock,ABD473,0,0,15|t++38085++flame_shock,C41F3B,1,0,15|t++36667++lava_burst,C41F3B,2,0,15|t++12659++lightning_bolt,ABD473,3,0,15& http://8.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Shaerlyn+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:39,26,16,9,7,3,3,3,0&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,C41F3B,ABD473,C41F3B,ABD473,C41F3B,C41F3B,C41F3B&chl=lava_burst|lightning_bolt|molten_earth|fulmination|flame_shock|earth_shock|searing_totem: searing_bolt|greater_fire_elemental: melee|greater_fire_elemental: fire_blast&
http://0.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Shaerlyn+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:Ybeinqtwy25678530ywwvtroljhfecabbbbcbbaZYYYYXXWWWWVVVUUTTTTTSTTTTTUUUUUUUUUUTUTTUUUUUUUUUTTTTTTTTUUUUVUUUUUTTTTUUVVWWXXXYYYZZabcddeeeeedcbbaaZZYYXXXWVUUTTTTUUUUUUUUUUUUUUTTTTTTTUVVWXYYZaabbcdeeeefedcccbbaZZYXXVVUUUUVVVVVVVUUUUUUUUUUVVVVWWWWXXYZaabcdeeffeddccbbaaZZYYXWVVUTTTTTTTUUUUUUUTTTTTTTTTTTTTTTTTTTTTTUUUUUVVVVUUUUUUUUUUUUUUUUUUVUVVVVVVVUUUUUUUUUUUUTUUVVWWVUTSRQPONM&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.421154,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=27337|max=64911&chxp=1,1,42,100 http://3.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Shaerlyn+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,5,6,22,34,56,80,122,199,270,396,479,582,768,877,1022,1164,1212,1276,1320,1314,1391,1346,1375,1217,1176,1135,974,867,840,673,573,495,414,324,270,189,154,117,75,67,42,29,17,14,8,6,2,2,2&chds=0,1391&chbh=5&chxt=x&chxl=0:|min=24577|avg=27337|max=30795&chxp=0,1,44,100& http://9.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Shaerlyn+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:52.0,27.4,7.5,6.7,4.5,1.3,0.5&chds=0,100&chdls=ffffff&chco=ABD473,C41F3B,C41F3B,ABD473,C41F3B,C41F3B,C41F3B&chl=lightning_bolt 156.5s|lava_burst 82.5s|unleash_flame 22.6s|earth_shock 20.1s|flame_shock 13.4s|searing_totem 3.9s|fire_elemental_totem 1.5s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Shaerlyn 27337
earth_shock 900 (3345) 3.3% (12.2%) 16.4 17.96sec 61183 49939 Direct 16.4 9730 24306 11986 15.5% 15.1 3941 9833 15.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.43 16.43 0.00 0.00 1.2252 0.0000 270331.39 270331.39 0.00 49938.91 49938.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.34 15.44% 9832.88 5763 14665 8933.21 0 14665 22985 22985 0.00
multistrike 12.80 84.56% 3941.28 2305 5866 3944.92 2782 5008 50452 50452 0.00
hit 13.88 84.52% 9729.86 5692 14484 9737.12 7690 11658 135098 135098 0.00
crit 2.54 15.48% 24305.76 14230 36209 22748.60 0 36209 61797 61797 0.00
 
DPS Timeline Chart
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lightning_shield.react=buff.lightning_shield.max_stack
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing {$s1=1119} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.925000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    fulmination 2445 9.0% 16.4 17.96sec 44726 0 Direct 16.4 26414 66092 32553 15.5% 15.2 10696 26743 15.4%  

Stats details: fulmination

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.43 16.43 0.00 0.00 0.0000 0.0000 734739.16 734739.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.34 15.41% 26742.65 21146 37866 24219.86 0 37866 62589 62589 0.00
multistrike 12.84 84.59% 10696.31 8459 15146 10710.53 8571 12954 137380 137380 0.00
hit 13.89 84.53% 26413.94 20885 37399 26448.96 22784 30270 366772 366772 0.00
crit 2.54 15.47% 66092.30 52213 93496 61512.48 0 93496 167998 167998 0.00
 
DPS Timeline Chart
 

Action details: fulmination

Static Values
  • id:88766
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:26364
  • name:Lightning Shield
  • school:nature
  • tooltip:
  • description:Discharges lightning at an attacker, dealing {$s1=274} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.226305
  • base_dd_min:0.00
  • base_dd_max:0.00
 
flame_shock 1706 6.2% 10.7 29.20sec 47679 38085 Direct 10.7 4065 10154 5007 15.5% 9.8 1646 4109 15.5%  
Periodic 124.8 2073 5181 2551 15.4% 115.7 840 2100 15.4% 98.9%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.73 10.73 124.82 124.82 1.2520 2.3848 511823.04 511823.04 0.00 1645.16 38084.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.52 15.48% 4109.31 2181 6635 3245.42 0 6635 6250 6250 0.00
multistrike 8.31 84.52% 1645.63 873 2654 1648.17 0 2502 13670 13670 0.00
hit 9.07 84.52% 4064.70 2154 6553 4073.05 2729 5423 36881 36881 0.00
crit 1.66 15.48% 10154.37 5386 16382 8443.32 0 16382 16870 16870 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 17.9 15.43% 2100.34 1091 3319 2104.04 1348 2800 37512 37512 0.00
multistrike 97.9 84.57% 839.87 436 1327 841.51 609 1082 82183 82183 0.00
hit 105.6 84.60% 2072.86 3 3278 2076.82 1539 2611 218891 218891 0.00
crit 19.2 15.40% 5180.51 7 8194 5190.97 3497 7010 99567 99567 0.00
 
DPS Timeline Chart
 

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:400.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains<=9
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=424} Fire damage and then an additional $o1 Fire damage over {$d=30 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.350000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:1.00
  • dot_duration:30.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
lava_burst 10110 36.8% 60.6 4.91sec 49914 36667 Direct 60.5 0 34501 34501 100.0% 67.0 0 13991 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.57 60.46 0.00 0.00 1.3613 0.0000 3023460.52 3023460.52 0.00 36666.67 36666.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 67.00 100.00% 13990.63 10687 19864 13998.48 12888 15467 937433 937433 0.00
crit 60.46 100.00% 34500.84 26388 49048 34520.61 32700 36265 2086027 2086027 0.00
 
DPS Timeline Chart
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:160.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=932} Fire damage. Lava Burst will always deal a critical strike. If your Flame Shock is on the target, Lava Burst will deal $8050m3% additional damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.770000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
lightning_bolt 6575 24.1% 95.7 2.92sec 20695 12659 Direct 95.4 12307 30768 15153 15.4% 87.1 4985 12459 15.5%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.74 95.45 0.00 0.00 1.6348 0.0000 1981343.48 1981343.48 0.00 12659.13 12659.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.47 15.46% 12458.86 10253 16088 12462.96 10253 15395 167880 167880 0.00
multistrike 73.66 84.54% 4984.86 4101 6435 4986.06 4629 5336 367199 367199 0.00
hit 80.73 84.59% 12307.47 10127 15890 12310.62 11667 12878 993643 993643 0.00
crit 14.71 15.41% 30768.16 25317 39724 30773.76 25317 37449 452622 452622 0.00
 
DPS Timeline Chart
 

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:560.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Fires a bolt of lightning at the target, dealing {$s1=1065} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.880000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
molten_earth 4056 14.8% 125.5 2.38sec 9703 0 Direct 125.1 5760 14399 7092 15.4% 115.1 2335 5840 15.5%  

Stats details: molten_earth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.54 125.06 0.00 0.00 0.0000 0.0000 1218138.30 1218138.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 17.80 15.46% 5839.96 5377 7601 5844.86 5377 6807 103953 103953 0.00
multistrike 97.33 84.54% 2335.28 2151 3040 2337.12 2235 2507 227294 227294 0.00
hit 105.78 84.58% 5759.83 5310 7507 5764.31 5564 6030 609256 609256 0.00
crit 19.28 15.42% 14398.85 13276 18768 14408.78 13276 16610 277636 277636 0.00
 
DPS Timeline Chart
 

Action details: molten_earth

Static Values
  • id:170379
  • school:fire
  • resource:none
  • range:45.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:170379
  • name:Molten Earth
  • school:fire
  • tooltip:
  • description:{$@spelldesc170374=Your damaging spells incite the earth around you to come to your aid for {$170377d=6 seconds}, repeatedly dealing ${($m1/100)*($170379m1+{$170379m2=0})/2} Fire damage to your most recently attacked target. Also increases the damage of your Earthquake by {$s3=0}%.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_fire_elemental 2868 / 715
fire_blast 203 0.2% 12.7 15.53sec 1220 0 Direct 12.7 775 1938 954 15.4% 11.8 233 583 15.4%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.71 12.71 0.00 0.00 0.0000 0.0000 15504.47 15504.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.81 15.36% 582.58 530 749 483.89 0 749 1052 1052 0.00
multistrike 9.95 84.64% 233.26 212 299 234.71 212 299 2322 2322 0.00
hit 10.75 84.59% 774.91 706 998 779.66 706 925 8332 8332 0.00
crit 1.96 15.41% 1938.44 1765 2495 1680.75 0 2495 3798 3798 0.00
 
DPS Timeline Chart
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.459030
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 2665 2.4% 73.4 2.55sec 2737 2797 Direct 73.4 1738 4344 2140 15.4% 68.0 523 1308 15.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.38 73.38 0.00 0.00 0.9783 0.0000 200810.71 200810.71 0.00 2797.24 2797.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 10.46 15.38% 1307.52 1154 1631 1314.27 0 1631 13678 13678 0.00
multistrike 57.56 84.62% 522.81 461 652 525.48 477 580 30094 30094 0.00
hit 62.05 84.56% 1737.58 1538 2174 1746.41 1626 1836 107819 107819 0.00
crit 11.33 15.44% 4344.01 3845 5436 4365.87 0 5436 49220 49220 0.00
 
DPS Timeline Chart
 

Action details: melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - searing_totem 1205 / 831
searing_bolt 1205 3.0% 122.2 1.83sec 2038 0 Direct 121.9 1301 3252 1602 15.4% 111.9 390 976 15.4%  

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.23 121.91 0.00 0.00 0.0000 0.0000 249074.15 249074.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 17.29 15.44% 975.70 924 1115 975.30 924 1076 16866 16866 0.00
multistrike 94.64 84.56% 390.29 369 446 390.16 374 406 36937 36937 0.00
hit 103.12 84.59% 1300.97 1232 1486 1300.50 1256 1334 134157 134157 0.00
crit 18.79 15.41% 3252.25 3079 3716 3251.03 3079 3599 61114 61114 0.00
 
DPS Timeline Chart
 

Action details: searing_bolt

Static Values
  • id:3606
  • school:fire
  • resource:none
  • range:25.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3606
  • name:Searing Bolt
  • school:fire
  • tooltip:
  • description:Deals Fire damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Shaerlyn
ascendance 2.0 181.24sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.02 2.02 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.71 84.63% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.31 15.37% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: ascendance

Static Values
  • id:165339
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:1664.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:active_enemies>1|(dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=60)&cooldown.lava_burst.remains>0)
Spelldata
  • id:165339
  • name:Ascendance
  • school:physical
  • tooltip:
  • description:The Shaman transforms into a Flame Ascendant for {$114051d=15 seconds}. While in this form, Lava Burst has no cooldown and Chain Lightning is empowered to become Lava Beam.
 
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
elemental_mastery 3.0 121.19sec

Stats details: elemental_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: elemental_mastery

Static Values
  • id:16166
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:action.lava_burst.cast_time>=1.2
Spelldata
  • id:16166
  • name:Elemental Mastery
  • school:nature
  • tooltip:Haste increased by {$s1=30}%.
  • description:Elemental forces empower you with {$s1=30}% haste for {$d=20 seconds}.
 
fire_elemental_totem 1.5 0.00sec

Stats details: fire_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.49 1.49 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: fire_elemental_totem

Static Values
  • id:2894
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:8607.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2894
  • name:Fire Elemental Totem
  • school:fire
  • tooltip:
  • description:Summons a Fire Totem with {$s1=1} health at the feet of the caster, calling forth a Greater Fire Elemental to rain destruction on the caster's enemies. Lasts {$d=60 seconds}.
 
lightning_shield 1.0 0.00sec

Stats details: lightning_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.84 84.46% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.16 15.54% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: lightning_shield

Static Values
  • id:324
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.lightning_shield.up
Spelldata
  • id:324
  • name:Lightning Shield
  • school:nature
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When an attack hits the caster, the attacker will be struck for {$26364s1=274} Nature damage. This effect may only occur once every few seconds. Lasts {$d=3600 seconds}.
 
searing_totem 3.9 66.15sec

Stats details: searing_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.87 3.87 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!talent.liquid_magma.enabled&!totem.fire.active)|(talent.liquid_magma.enabled&pet.searing_totem.remains<=20&!pet.fire_elemental_totem.active&!buff.liquid_magma.up)
Spelldata
  • id:3599
  • name:Searing Totem
  • school:fire
  • tooltip:
  • description:Summons a Fire Totem with {$?s63298=false}[{$s1=5}% of the caster's][{$s1=5}] health at the feet of the caster for {$d=60 seconds} that repeatedly attacks an enemy within $3606r1 yards for {$3606s1=243} Fire damage.
 
unleash_flame 18.3 16.83sec

Stats details: unleash_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.33 18.33 0.00 0.00 1.2342 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: unleash_flame

Static Values
  • id:165462
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1120.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:165462
  • name:Unleash Flame
  • school:fire
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes elemental forces of Flame, increasing the damage dealt by the Shaman's next Fire spell by {$s2=40}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
ascendance 2.0 0.0 181.2sec 181.2sec 10.16% 10.17% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • ascendance_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Autoattacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, transforming into a being of raw elemental energy for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 32.89% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_intellect_potion 2.0 0.0 185.5sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
elemental_fusion 23.3 37.2 13.0sec 4.9sec 57.08% 83.53% 22.8(22.8)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_elemental_fusion
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • elemental_fusion_1:32.96%
  • elemental_fusion_2:24.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157174
  • name:Elemental Fusion
  • tooltip:Damage of your next Shock increased by $w1%.
  • description:{$@spelldesc152257=Your Lava Burst and Lava Lash increase the damage of your next Shock by {$157174s1=40}%, stacking up to 2 times.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_mastery 3.0 0.0 121.1sec 121.2sec 19.24% 40.93% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_elemental_mastery
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • elemental_mastery_1:19.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:16166
  • name:Elemental Mastery
  • tooltip:Haste increased by {$s1=30}%.
  • description:Elemental forces empower you with {$s1=30}% haste for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
enhanced_unleash 18.3 0.0 16.8sec 16.8sec 24.20% 24.21% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_enhanced_unleash
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enhanced_unleash_1:24.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162557
  • name:Enhanced Unleash
  • tooltip:Movement speed increased by {$s1=30}%.
  • description:{$@spelldesc157784=Your {$?s165462=true}[Unleash Flame]?s73685[Unleash Life][Unleash Elements] ability also causes you to gain {$162557s1=30}% increased movement speed for {$162557d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lava_surge 24.8 0.2 11.7sec 11.7sec 10.32% 43.92% 0.2(0.2)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lava_surge_1:10.32%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:77756
  • name:Lava Surge
  • tooltip:
  • description:Your Flame Shock damage over time has a chance to reset the cooldown of your Lava Burst spell and cause your next Lava Burst spell to be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
mark_of_the_frostwolf 13.5 4.1 22.7sec 17.2sec 30.98% 30.99% 1.0(1.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_mark_of_the_frostwolf
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stat Buff details

  • stat:multistrike_rating
  • amount:500.00

Stack Uptimes

  • mark_of_the_frostwolf_1:23.73%
  • mark_of_the_frostwolf_2:7.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159676
  • name:Mark of the Frostwolf
  • tooltip:Multistrike increased by $w1.
  • description:Increases multistrike by {$s1=500}.
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
sudden_clarity 3.0 0.0 120.8sec 120.8sec 19.29% 19.31% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_sudden_clarity
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:spell_power
  • amount:1100.00

Stack Uptimes

  • sudden_clarity_1:19.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:177594
  • name:Sudden Clarity
  • tooltip:Increases spellpower by {$s1=653}.
  • description:Increases your spellpower by {$s1=653} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
unleash_flame 18.3 0.0 16.8sec 16.8sec 25.74% 25.25% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_unleash_flame
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • unleash_flame_1:25.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:73683
  • name:Unleash Flame
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, increasing the damage dealt by the Shaman's next Fire spell by {$s2=40}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
unleashed_fury 18.3 0.0 16.8sec 16.8sec 59.88% 63.45% 0.0(0.0)

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_unleashed_fury
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • unleashed_fury_1:59.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118470
  • name:Unleashed Fury
  • tooltip:Increases damage dealt by Lightning Bolt by {$s1=30}% and Lava Burst by {$s2=10}%.
  • description:Increases the damage dealt by your Lightning Bolt by {$s1=30}% and Lava Burst by {$s2=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
lightning_shield

Buff details

  • buff initial source:Shaerlyn
  • cooldown name:buff_lightning_shield
  • max_stacks:20
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • lightning_shield_1:11.08%
  • lightning_shield_2:3.62%
  • lightning_shield_3:7.01%
  • lightning_shield_4:5.83%
  • lightning_shield_5:4.79%
  • lightning_shield_6:5.12%
  • lightning_shield_7:5.08%
  • lightning_shield_8:5.14%
  • lightning_shield_9:5.23%
  • lightning_shield_10:5.20%
  • lightning_shield_11:5.19%
  • lightning_shield_12:5.12%
  • lightning_shield_13:5.10%
  • lightning_shield_14:5.02%
  • lightning_shield_15:5.00%
  • lightning_shield_16:4.18%
  • lightning_shield_17:3.66%
  • lightning_shield_18:2.78%
  • lightning_shield_19:2.12%
  • lightning_shield_20:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:324
  • name:Lightning Shield
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When an attack hits the caster, the attacker will be struck for {$26364s1=274} Nature damage. This effect may only occur once every few seconds. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Shaerlyn
ascendance Mana 2.0 3368.7 1664.0 1664.0 0.0
earth_shock Mana 16.4 6570.9 400.0 400.0 153.0
fire_elemental_totem Mana 1.5 12858.5 8607.0 8606.5 0.0
flame_shock Mana 10.7 4293.9 400.0 400.0 119.2
lava_burst Mana 60.6 9691.7 160.0 160.0 312.0
lightning_bolt Mana 95.7 53615.6 560.0 560.0 37.0
searing_totem Mana 3.9 3715.9 960.0 960.0 0.0
unleash_flame Mana 18.3 20524.0 1120.0 1120.0 0.0
Resource Gains Type Count Total Average Overflow
external_healing Health 8.45 0.00 (0.00%) 0.00 78934.00 100.00%
mp5_regen Mana 206.84 114159.74 (100.00%) 551.92 250808.54 68.72%
Resource RPS-Gain RPS-Loss
Mana 379.40 380.99
Combat End Resource Mean Min Max
Mana 159507.67 151393.00 160000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 65.3%
primal_fire_elemental-Mana Cap 65.3%
greater_fire_elemental-Mana Cap 65.3%
primal_storm_elemental-Mana Cap 65.3%
greater_storm_elemental-Mana Cap 65.3%
primal_earth_elemental-Mana Cap 65.3%
greater_earth_elemental-Mana Cap 65.3%
lightning_elemental-Mana Cap 65.3%
earth_elemental_totem-Mana Cap 65.3%
fire_elemental_totem-Mana Cap 65.3%
storm_elemental_totem-Mana Cap 65.3%
magma_totem-Mana Cap 65.3%
searing_totem-Mana Cap 65.3%

Procs

Count Interval
Elemental Fusion: Earth Shock 16.4 18.0sec
Elemental Fusion: Flame Shock 10.7 29.2sec
lava_surge 25.0 11.7sec
uf_flame_shock 5.4 53.9sec
uf_lava_burst 12.6 21.9sec
wasted_lava_surge 0.2 73.3sec
wasted_lightning_shield 13.1 34.2sec
lava_surge_during_lvb 4.9 50.5sec
Fulmination: 15 stacks 2.4 70.3sec
Fulmination: 16 stacks 2.5 69.3sec
Fulmination: 17 stacks 2.3 72.2sec
Fulmination: 18 stacks 1.9 77.6sec
Fulmination: 19 stacks 7.5 38.9sec
Fulmination: Generate 310.1 1.9sec

Statistics & Data Analysis

Fight Length
Sample Data Shaerlyn Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Shaerlyn Damage Per Second
Count 25000
Mean 27337.37
Minimum 24577.25
Maximum 30794.83
Spread ( max - min ) 6217.58
Range [ ( max - min ) / 2 * 100% ] 11.37%
Standard Deviation 873.3495
5th Percentile 25964.36
95th Percentile 28830.54
( 95th Percentile - 5th Percentile ) 2866.18
Mean Distribution
Standard Deviation 5.5235
95.00% Confidence Intervall ( 27326.54 - 27348.19 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3920
0.1 Scale Factor Error with Delta=300 6511
0.05 Scale Factor Error with Delta=300 26044
0.01 Scale Factor Error with Delta=300 651118
Distribution Chart
DPS(e)
Sample Data Shaerlyn Damage Per Second (Effective)
Count 25000
Mean 27337.37
Minimum 24577.25
Maximum 30794.83
Spread ( max - min ) 6217.58
Range [ ( max - min ) / 2 * 100% ] 11.37%
Damage
Sample Data Shaerlyn Damage
Count 25000
Mean 7739835.89
Minimum 5722191.85
Maximum 9855999.49
Spread ( max - min ) 4133807.64
Range [ ( max - min ) / 2 * 100% ] 26.70%
DTPS
Sample Data Shaerlyn Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shaerlyn Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Shaerlyn Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shaerlyn Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shaerlyn Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shaerlyn Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data ShaerlynTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Shaerlyn Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=calamari_crepes
2 0.00 lightning_shield,if=!buff.lightning_shield.up
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=draenic_intellect
Default action list Executed every time the actor is available.
# count action,conditions
5 0.00 wind_shear
6 0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 3.01 use_item,name=copelands_clarity
8 1.00 potion,name=draenic_intellect,if=buff.ascendance.up|target.time_to_die<=30
In-combat potion is preferentially linked to Ascendance, unless combat will end shortly
9 0.00 berserking,if=!buff.bloodlust.up&!buff.elemental_mastery.up&(set_bonus.tier15_4pc_caster=1|(buff.ascendance.cooldown_remains=0&(dot.flame_shock.remains>buff.ascendance.duration|level<87)))
A 0.00 blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
B 0.00 arcane_torrent
C 3.00 elemental_mastery,if=action.lava_burst.cast_time>=1.2
D 0.00 ancestral_swiftness,if=!buff.ascendance.up
E 0.00 storm_elemental_totem
F 1.49 fire_elemental_totem,if=!active
G 2.02 ascendance,if=active_enemies>1|(dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=60)&cooldown.lava_burst.remains>0)
H 0.00 liquid_magma,if=pet.searing_totem.remains>=15|pet.fire_elemental_totem.remains>=15
I 0.00 call_action_list,name=single,if=active_enemies=1
If only one enemy, priority follows the 'single' action list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On multiple enemies, the priority follows the 'aoe' action list.
actions.single Single target action priority list
# count action,conditions
K 0.00 unleash_flame,moving=1
L 0.00 spiritwalkers_grace,moving=1,if=buff.ascendance.up
M 5.30 earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
N 60.69 lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
O 18.32 unleash_flame,if=talent.unleashed_fury.enabled&!buff.ascendance.up
P 10.17 flame_shock,if=dot.flame_shock.remains<=9
Q 11.13 earth_shock,if=(set_bonus.tier17_4pc&buff.lightning_shield.react>=15&!buff.lava_surge.up)|(!set_bonus.tier17_4pc&buff.lightning_shield.react>15)
R 0.00 earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&buff.elemental_mastery.down&buff.bloodlust.down
S 0.00 earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=1.3*(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.up|buff.bloodlust.up)
T 0.00 earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.remains>=10|buff.bloodlust.remains>=10)
U 0.00 earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&buff.elemental_mastery.down&buff.bloodlust.down
V 0.00 earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=1.3*((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.up|buff.bloodlust.up)
W 0.00 earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.remains>=10|buff.bloodlust.remains>=10)
X 0.00 elemental_blast
Y 0.57 flame_shock,if=time>60&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<duration
After the initial Ascendance, use Flame Shock pre-emptively just before Ascendance to guarantee Flame Shock staying up for the full duration of the Ascendance buff
Z 3.87 searing_totem,if=(!talent.liquid_magma.enabled&!totem.fire.active)|(talent.liquid_magma.enabled&pet.searing_totem.remains<=20&!pet.fire_elemental_totem.active&!buff.liquid_magma.up)
Keep Searing Totem up, unless Fire Elemental Totem is coming off cooldown in the next 20 seconds
a 0.00 spiritwalkers_grace,moving=1,if=((talent.elemental_blast.enabled&cooldown.elemental_blast.remains=0)|(cooldown.lava_burst.remains=0&!buff.lava_surge.react))
b 96.30 lightning_bolt

Sample Sequence

01247CFOPNGNNNNNNNNNNMNNNNNONbNPbbbMbNbbNObbbQbNbbbOPbNbQNZbbObNbbbbQNbOPbbNbbbNMONbbbbNNPbObQ7CNbbZbNbNbMNObbbbbNPbbbMONbbbbbNQbObYbNbbbbNG8NNNMNNNNNOZPbbbNbNQObbbNbbbbONPbbbM7CbNbObbbbQNbNbNbbOPZbNMNbbbObNbbQbbN

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana
Pre food Fluffy_Pillow 160000.0/160000: 100% mana
Pre lightning_shield Fluffy_Pillow 160000.0/160000: 100% mana
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana draenic_intellect_potion
0:00.000 use_item_copelands_clarity Fluffy_Pillow 160000.0/160000: 100% mana draenic_intellect_potion
0:00.000 elemental_mastery Fluffy_Pillow 160000.0/160000: 100% mana draenic_intellect_potion, sudden_clarity
0:00.000 fire_elemental_totem Fluffy_Pillow 160000.0/160000: 100% mana elemental_mastery, draenic_intellect_potion, sudden_clarity
0:01.005 unleash_flame Fluffy_Pillow 152615.1/160000: 95% mana bloodlust, elemental_mastery, draenic_intellect_potion, sudden_clarity
0:02.010 flame_shock Fluffy_Pillow 152717.2/160000: 95% mana bloodlust, unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, draenic_intellect_potion, sudden_clarity
0:03.014 lava_burst Fluffy_Pillow 153538.0/160000: 96% mana bloodlust, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:04.056 ascendance Fluffy_Pillow 154645.1/160000: 97% mana bloodlust, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:04.056 lava_burst Fluffy_Pillow 152981.1/160000: 96% mana bloodlust, ascendance, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, draenic_intellect_potion, sudden_clarity
0:05.097 lava_burst Fluffy_Pillow 154087.0/160000: 96% mana bloodlust, ascendance, elemental_fusion, unleashed_fury, elemental_mastery, mark_of_the_frostwolf(2), draenic_intellect_potion, sudden_clarity
0:06.139 lava_burst Fluffy_Pillow 155194.0/160000: 97% mana bloodlust, ascendance, elemental_fusion(2), unleashed_fury, elemental_mastery, mark_of_the_frostwolf(2), draenic_intellect_potion, sudden_clarity
0:07.182 lava_burst Fluffy_Pillow 156302.3/160000: 98% mana bloodlust, ascendance, elemental_fusion(2), unleashed_fury, elemental_mastery, mark_of_the_frostwolf(2), draenic_intellect_potion, sudden_clarity
0:08.224 lava_burst Fluffy_Pillow 157409.4/160000: 98% mana bloodlust, ascendance, elemental_fusion(2), unleashed_fury, elemental_mastery, mark_of_the_frostwolf(2), draenic_intellect_potion, sudden_clarity
0:09.266 lava_burst Fluffy_Pillow 158516.5/160000: 99% mana bloodlust, ascendance, lava_surge, elemental_fusion(2), unleashed_fury, elemental_mastery, mark_of_the_frostwolf(2), draenic_intellect_potion, sudden_clarity
0:10.271 lava_burst Fluffy_Pillow 159578.5/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), unleashed_fury, elemental_mastery, mark_of_the_frostwolf(2), draenic_intellect_potion, sudden_clarity
0:11.313 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:12.354 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:13.396 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:14.437 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:15.439 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion, elemental_mastery, draenic_intellect_potion, sudden_clarity
0:16.480 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion, elemental_mastery, draenic_intellect_potion, sudden_clarity
0:17.520 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:18.561 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, ascendance, lava_surge, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:19.567 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2), elemental_mastery, draenic_intellect_potion, sudden_clarity
0:20.608 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2)
0:21.625 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lava_surge, elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
0:22.641 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2), unleashed_fury, enhanced_unleash
0:23.997 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lava_surge, elemental_fusion(2), unleashed_fury, enhanced_unleash
0:25.013 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2), unleashed_fury
0:26.028 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, unleashed_fury
0:27.380 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, unleashed_fury
0:28.735 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, unleashed_fury
0:30.089 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, unleashed_fury
0:31.105 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:32.459 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:33.814 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust
0:35.168 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lava_surge, elemental_fusion
0:36.522 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, lava_surge, elemental_fusion
0:37.537 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2)
0:38.553 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
0:39.907 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana bloodlust, elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
0:41.261 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
0:43.019 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury
0:44.340 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury
0:46.098 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, mark_of_the_frostwolf
0:47.856 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
0:49.615 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
0:51.372 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf(2)
0:53.131 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf(2)
0:54.452 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash, mark_of_the_frostwolf(2)
0:55.771 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, enhanced_unleash, mark_of_the_frostwolf(2)
0:57.528 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
0:59.286 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
1:01.044 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
1:02.362 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleashed_fury
1:03.681 searing_totem Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
1:04.685 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
1:06.441 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf(2)
1:08.199 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf(2)
1:09.519 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash, mark_of_the_frostwolf(2)
1:11.276 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash, mark_of_the_frostwolf(2)
1:13.032 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
1:14.790 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury
1:16.546 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury
1:18.303 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
1:20.062 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion(2)
1:21.381 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge
1:22.700 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
1:24.459 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
1:25.779 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
1:27.100 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, enhanced_unleash
1:28.858 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
1:30.616 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf
1:32.375 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf
1:34.132 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, mark_of_the_frostwolf
1:35.887 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, mark_of_the_frostwolf
1:37.645 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion
1:38.965 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
1:40.285 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana
1:41.606 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleash_flame, unleashed_fury, enhanced_unleash
1:42.928 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, enhanced_unleash
1:44.684 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
1:46.442 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
1:48.200 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
1:49.957 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
1:51.714 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion
1:53.032 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
1:54.352 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana
1:56.111 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana
1:57.429 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
1:59.186 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
2:00.508 use_item_copelands_clarity Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury
2:00.508 elemental_mastery Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, sudden_clarity
2:00.508 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, elemental_mastery, sudden_clarity
2:01.862 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, elemental_mastery, sudden_clarity
2:03.215 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, elemental_mastery, sudden_clarity
2:04.568 searing_totem Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, elemental_mastery, sudden_clarity
2:05.573 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, elemental_mastery, sudden_clarity
2:06.926 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, elemental_mastery, sudden_clarity
2:07.941 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion(2), elemental_mastery, sudden_clarity
2:09.297 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion(2), elemental_mastery, sudden_clarity
2:10.313 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), elemental_mastery, sudden_clarity
2:11.667 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), elemental_mastery, mark_of_the_frostwolf, sudden_clarity
2:12.682 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_mastery, mark_of_the_frostwolf, sudden_clarity
2:13.699 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, elemental_mastery, mark_of_the_frostwolf, sudden_clarity
2:14.714 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, sudden_clarity
2:16.069 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, sudden_clarity
2:17.421 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, mark_of_the_frostwolf, sudden_clarity
2:18.772 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, elemental_mastery, sudden_clarity
2:20.125 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, elemental_mastery, sudden_clarity
2:21.480 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury
2:23.238 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
2:24.557 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
2:26.315 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
2:28.072 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
2:29.830 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
2:31.149 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana
2:32.470 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
2:34.228 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, enhanced_unleash
2:35.984 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
2:37.741 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
2:39.498 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
2:41.255 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
2:43.012 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
2:44.771 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
2:46.090 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, mark_of_the_frostwolf
2:47.846 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
2:49.167 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
2:50.926 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
2:52.245 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
2:54.003 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
2:55.762 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
2:57.519 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury
2:59.276 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
3:01.031 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
3:02.789 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion
3:04.110 ascendance Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
3:04.110 potion Fluffy_Pillow 158336.0/160000: 99% mana ascendance, elemental_fusion(2)
3:04.110 lava_burst Fluffy_Pillow 158336.0/160000: 99% mana ascendance, elemental_fusion(2), draenic_intellect_potion
3:05.869 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), draenic_intellect_potion
3:07.628 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), mark_of_the_frostwolf, draenic_intellect_potion
3:09.387 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), mark_of_the_frostwolf, draenic_intellect_potion
3:10.707 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion, mark_of_the_frostwolf, draenic_intellect_potion
3:12.467 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion, mark_of_the_frostwolf, draenic_intellect_potion
3:14.224 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), draenic_intellect_potion
3:15.981 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), draenic_intellect_potion
3:17.737 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana ascendance, elemental_fusion(2), draenic_intellect_potion
3:19.495 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), draenic_intellect_potion
3:20.814 searing_totem Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash, draenic_intellect_potion
3:21.818 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash, draenic_intellect_potion
3:23.137 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, enhanced_unleash, draenic_intellect_potion
3:24.895 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, draenic_intellect_potion
3:26.652 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, draenic_intellect_potion
3:28.409 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, draenic_intellect_potion
3:30.166 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
3:31.924 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, mark_of_the_frostwolf
3:33.244 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), mark_of_the_frostwolf
3:34.563 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
3:35.883 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash, mark_of_the_frostwolf
3:37.641 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, enhanced_unleash
3:39.399 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury
3:41.156 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury
3:42.912 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
3:44.669 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
3:46.428 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
3:48.185 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
3:49.942 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion
3:51.262 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, enhanced_unleash
3:53.019 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, enhanced_unleash
3:54.340 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, mark_of_the_frostwolf
3:56.097 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, mark_of_the_frostwolf(2)
3:57.854 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, mark_of_the_frostwolf(2)
3:59.610 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleashed_fury, mark_of_the_frostwolf(2)
4:00.929 use_item_copelands_clarity Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf(2)
4:00.929 elemental_mastery Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf(2), sudden_clarity
4:00.929 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_mastery, mark_of_the_frostwolf(2), sudden_clarity
4:02.283 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana elemental_mastery, mark_of_the_frostwolf(2), sudden_clarity
4:03.636 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_mastery, mark_of_the_frostwolf(2), sudden_clarity
4:04.988 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, elemental_mastery, sudden_clarity
4:06.003 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, sudden_clarity
4:07.356 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, sudden_clarity
4:08.709 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, elemental_mastery, enhanced_unleash, sudden_clarity
4:10.061 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, elemental_mastery, sudden_clarity
4:11.414 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion, unleash_flame, unleashed_fury, elemental_mastery, sudden_clarity
4:12.428 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleash_flame, unleashed_fury, elemental_mastery, sudden_clarity
4:13.781 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, elemental_mastery, sudden_clarity
4:15.135 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, elemental_mastery, sudden_clarity
4:16.150 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), elemental_mastery, sudden_clarity
4:17.503 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion(2), elemental_mastery, sudden_clarity
4:18.518 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), elemental_mastery, sudden_clarity
4:19.870 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), elemental_mastery, sudden_clarity
4:21.222 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
4:22.542 flame_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
4:23.860 searing_totem Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, enhanced_unleash
4:24.864 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, enhanced_unleash
4:26.622 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury
4:28.380 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, unleashed_fury
4:29.699 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion, unleashed_fury
4:31.021 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury
4:32.779 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
4:34.536 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
4:36.292 unleash_flame Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2)
4:37.611 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
4:39.370 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana lava_surge, elemental_fusion(2), unleash_flame, unleashed_fury, enhanced_unleash
4:40.691 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury
4:42.447 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury
4:44.204 earth_shock Fluffy_Pillow 160000.0/160000: 100% mana elemental_fusion(2), unleashed_fury, mark_of_the_frostwolf
4:45.523 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana unleashed_fury, mark_of_the_frostwolf
4:47.280 lightning_bolt Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf
4:49.037 lava_burst Fluffy_Pillow 160000.0/160000: 100% mana mark_of_the_frostwolf

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 692 692
Agility 1483 1413 1413
Stamina 4524 4113 4113
Intellect 4114 3655 3537 (2375)
Spirit 784 784 784
Health 271440 246780 0
Mana 160000 160000 0
Spell Power 5855 4864 1209
Crit 18.43% 13.43% 927
Haste 14.04% 8.61% 861
Multistrike 42.94% 36.35% 1079
Damage / Heal Versatility 5.08% 2.08% 270
ManaReg per Second 1216 1216 0
Attack Power 1631 1413 0
Mastery 86.31% 63.81% 680
Armor 2003 2003 2003

Talents

Level
15 Nature's Guardian Stone Bulwark Totem Astral Shift
30 Frozen Power Earthgrab Totem Windwalk Totem
45 Call of the Elements Totemic Persistence Totemic Projection
60 Elemental Mastery Ancestral Swiftness Echo of the Elements
75 Rushing Streams Ancestral Guidance Conductivity
90 Unleashed Fury Primal Elementalist Elemental Blast
100 Elemental Fusion Storm Elemental Totem Liquid Magma

Profile

shaman="Shaerlyn"
origin="http://eu.battle.net/wow/en/character/forscherliga/Shaerlyn/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/96/5141344-avatar.jpg"
level=100
race=draenei
role=spell
position=back
professions=jewelcrafting=710/enchanting=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Wa!2220100
glyphs=chain_lightning/capacitor_totem/spiritwalkers_focus/lakestrider/astral_recall/ghostly_speed
spec=elemental

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=calamari_crepes
actions.precombat+=/lightning_shield,if=!buff.lightning_shield.up
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect

# Executed every time the actor is available.

actions=wind_shear
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions+=/bloodlust,if=target.health.pct<25|time>0.500
actions+=/use_item,name=copelands_clarity
# In-combat potion is preferentially linked to Ascendance, unless combat will end shortly
actions+=/potion,name=draenic_intellect,if=buff.ascendance.up|target.time_to_die<=30
actions+=/berserking,if=!buff.bloodlust.up&!buff.elemental_mastery.up&(set_bonus.tier15_4pc_caster=1|(buff.ascendance.cooldown_remains=0&(dot.flame_shock.remains>buff.ascendance.duration|level<87)))
actions+=/blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
actions+=/arcane_torrent
actions+=/elemental_mastery,if=action.lava_burst.cast_time>=1.2
actions+=/ancestral_swiftness,if=!buff.ascendance.up
actions+=/storm_elemental_totem
actions+=/fire_elemental_totem,if=!active
actions+=/ascendance,if=active_enemies>1|(dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=60)&cooldown.lava_burst.remains>0)
actions+=/liquid_magma,if=pet.searing_totem.remains>=15|pet.fire_elemental_totem.remains>=15
# If only one enemy, priority follows the 'single' action list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On multiple enemies, the priority follows the 'aoe' action list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

# Single target action priority list

actions.single=unleash_flame,moving=1
actions.single+=/spiritwalkers_grace,moving=1,if=buff.ascendance.up
actions.single+=/earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
actions.single+=/lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
actions.single+=/unleash_flame,if=talent.unleashed_fury.enabled&!buff.ascendance.up
actions.single+=/flame_shock,if=dot.flame_shock.remains<=9
actions.single+=/earth_shock,if=(set_bonus.tier17_4pc&buff.lightning_shield.react>=15&!buff.lava_surge.up)|(!set_bonus.tier17_4pc&buff.lightning_shield.react>15)
actions.single+=/earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&buff.elemental_mastery.down&buff.bloodlust.down
actions.single+=/earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=1.3*(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.up|buff.bloodlust.up)
actions.single+=/earthquake,if=!talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=(1.875+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.remains>=10|buff.bloodlust.remains>=10)
actions.single+=/earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&buff.elemental_mastery.down&buff.bloodlust.down
actions.single+=/earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=1.3*((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.up|buff.bloodlust.up)
actions.single+=/earthquake,if=talent.unleashed_fury.enabled&((1+stat.spell_haste)*(1+(mastery_value*2%4.5))>=((1.3*1.875)+(1.25*0.226305)+1.25*(2*0.226305*stat.multistrike_pct%100)))&target.time_to_die>10&(buff.elemental_mastery.remains>=10|buff.bloodlust.remains>=10)
actions.single+=/elemental_blast
# After the initial Ascendance, use Flame Shock pre-emptively just before Ascendance to guarantee Flame Shock staying up for the full duration of the Ascendance buff
actions.single+=/flame_shock,if=time>60&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<duration
# Keep Searing Totem up, unless Fire Elemental Totem is coming off cooldown in the next 20 seconds
actions.single+=/searing_totem,if=(!talent.liquid_magma.enabled&!totem.fire.active)|(talent.liquid_magma.enabled&pet.searing_totem.remains<=20&!pet.fire_elemental_totem.active&!buff.liquid_magma.up)
actions.single+=/spiritwalkers_grace,moving=1,if=((talent.elemental_blast.enabled&cooldown.elemental_blast.remains=0)|(cooldown.lava_burst.remains=0&!buff.lava_surge.react))
actions.single+=/lightning_bolt

# Multi target action priority list

actions.aoe=earthquake,cycle_targets=1,if=!ticking&(buff.enhanced_chain_lightning.up|level<=90)&active_enemies>=2
actions.aoe+=/lava_beam
actions.aoe+=/earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
actions.aoe+=/thunderstorm,if=active_enemies>=10
actions.aoe+=/searing_totem,if=(!talent.liquid_magma.enabled&!totem.fire.active)|(talent.liquid_magma.enabled&pet.searing_totem.remains<=20&!pet.fire_elemental_totem.active&!buff.liquid_magma.up)
actions.aoe+=/chain_lightning,if=active_enemies>=2
actions.aoe+=/lightning_bolt

head=hood_of_dispassionate_execution,id=113608,bonus_id=566
neck=primal_gladiators_pendant_of_cruelty,id=115655,enchant=75mult
shoulders=primal_gladiators_ringmail_spaulders,id=115724
back=cloak_of_searing_shadows,id=113847,bonus_id=564/566,gems=50mult,enchant=gift_of_multistrike
chest=undying_chestguard,id=114498,bonus_id=53
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=bracers_of_the_crying_chorus,id=113826,bonus_id=564/566,gems=50mult
hands=chainhoof_grips,id=115427
waist=belt_of_imminent_lies,id=113827
legs=exceptional_crystalleaf_legguards,id=116929
feet=undying_boots,id=114503,bonus_id=146
finger1=timeless_solium_band_of_the_archmage,id=118296,enchant=50mult
finger2=whispering_taladite_ring,id=115798,bonus_id=76/527/540,enchant=50mult
trinket1=quiescent_runestone,id=113859
trinket2=copelands_clarity,id=118878
main_hand=butchers_terrible_tenderizer,id=113607,enchant=mark_of_the_frostwolf
off_hand=maw_of_souls,id=113653,bonus_id=564/566,gems=50mult

# Gear Summary
# gear_stamina=3223
# gear_intellect=2375
# gear_spell_power=1209
# gear_crit_rating=927
# gear_haste_rating=861
# gear_mastery_rating=680
# gear_armor=2003
# gear_multistrike_rating=1028
# gear_versatility_rating=270

Candylicious

Candylicious : 24994 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
24994.5 24994.5 7.8 / 0.031% 2433.6 / 9.7% 1.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
14233.4 14233.4 Mana 3.01% 42.8 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Candylicious/advanced
Talents
  • 15: Soul Leech
  • 30: Shadowfury
  • 45: Soul Link
  • 60: Blood Horror
  • 75: Grimoire of Supremacy
  • 90: Kil'jaeden's Cunning
  • 100: Demonic Servitude
  • Talent Calculator
Glyphs
  • Glyph of Siphon Life
  • Glyph of Havoc
  • Glyph of Demon Training
  • Glyph of Nightmares
  • Glyph of Verdant Spheres
Professions
  • inscription: 189
  • tailoring: 700

Charts

http://1.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=Candylicious+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x150&chd=t:35275|33668|23301|11670&chds=0,70550&chco=C41F3B,9482C9,C41F3B,C41F3B&chm=t++35275++immolate,C41F3B,0,0,15|t++33668++chaos_bolt,9482C9,1,0,15|t++23301++conflagrate,C41F3B,2,0,15|t++11670++incinerate,C41F3B,3,0,15& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Candylicious+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:40,38,32,17,11&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,9482C9,C41F3B,C41F3B&chl=incinerate|terrorguard: doom_bolt|chaos_bolt|immolate|conflagrate&
http://4.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Candylicious+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:Vceossvwz376566876543xyomnnnmkggfgfedcbdddcdbcbbbbcccbbbbcdbdcbdeddcbcbbccbddcddbcdabcacecdcbddbccbbdcdcbccccdbccbccggljlmnpqqrrrqstuttuprmmjjggedddcdcZaaZZYWYYYZYXZZXZZYYYZZZYZaZaaZbbbdcbbbbdcbcddefcddcdcbddfefeeeffeedffgggffffdgffffcgghkkmmpqsusttruuuwxuwurrommkhhhgihfffdfdbccbeeddeceeceedfeeefffgfffghhhhggggggfhhghhfghefgehhhihghigiigijijkijjijihjjiiigiighgdcbYXWTSQO&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.557386,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=24994|max=44842&chxp=1,1,56,100 http://7.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=Candylicious+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:2,1,4,1,3,11,30,40,53,94,146,244,332,453,545,736,848,1024,1094,1268,1349,1348,1410,1498,1535,1417,1328,1249,1226,1039,1003,815,672,531,426,356,257,177,135,100,70,50,29,19,10,7,5,5,3,2&chds=0,1535&chbh=5&chxt=x&chxl=0:|min=22647|avg=24994|max=27521&chxp=0,1,48,100& http://3.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=Candylicious+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:62.4,17.0,8.8,8.6,3.0&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,C41F3B,C41F3B,ffffff&chl=incinerate 187.9s|chaos_bolt 51.1s|conflagrate 26.5s|immolate 25.7s|waiting 9.1s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Candylicious 24994
chaos_bolt 5731 22.9% 24.8 12.03sec 69460 33668 Direct 24.6 0 62580 62580 100.0% 9.7 0 18779 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.76 24.56 0.00 0.00 2.0631 0.0000 1720093.16 1720093.16 0.00 33667.90 33667.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 9.74 100.00% 18778.88 16089 24642 18803.94 0 24642 182856 182856 0.00
crit 24.56 100.00% 62579.59 53629 82140 62661.66 59249 67098 1537237 1537237 0.00
 
DPS Timeline Chart
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:shadow
  • resource:burning_ember
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.havoc.remains>cast_time&buff.havoc.stack>=3
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:shadow
  • tooltip:Deals Shadow damage every $t2 sec.
  • description:Unleashes a blast of chaos, causing ${$m1*(1+$77220m1/100*$<masteryMod>)} Shadow damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.{$?s116858=true}[][ Replaces Soul Fire.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.107500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
conflagrate 2056 8.2% 26.4 11.57sec 23405 23301 Direct 26.4 16172 33104 20920 28.0% 10.5 4852 9932 27.9%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.37 26.37 0.00 0.00 1.0045 0.0000 617263.65 617263.65 0.00 23300.88 23300.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.92 27.94% 9932.47 9417 11213 9415.26 0 11213 29007 29007 0.00
multistrike 7.53 72.06% 4851.67 4708 5606 4850.94 0 5606 36544 36544 0.00
hit 18.98 71.96% 16172.19 15694 18688 16177.69 15694 17076 306912 306912 0.00
crit 7.39 28.04% 33104.18 31389 37376 33152.24 0 37376 244801 244801 0.00
 
DPS Timeline Chart
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:6400.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Target enemy instantly explodes, dealing {$s1=2778} Fire damage{$?s56235=false}[, reducing movement speed by {$s2=50}% for {$d=5 seconds},][] and generating Burning Embers.{$?s56235=false}[][ Targets afflicted by Immolate will have {$s2=50}% reduced movement speed for {$d=5 seconds}.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.890000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
immolate 3021 12.1% 20.6 14.90sec 44064 35275 Direct 20.6 7821 15996 9970 26.3% 8.2 2346 4796 26.2%  
Periodic 122.4 3891 7915 4950 26.3% 48.5 1170 2381 26.3% 99.3%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.60 20.60 122.38 122.38 1.2492 2.4413 907798.83 907798.83 0.00 2797.47 35274.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.14 26.21% 4796.01 4567 5438 4246.00 0 5438 10244 10244 0.00
multistrike 6.01 73.79% 2346.45 2284 2719 2342.58 0 2719 14113 14113 0.00
hit 15.19 73.71% 7821.13 7612 9063 7823.53 7612 8338 118777 118777 0.00
crit 5.42 26.29% 15995.94 15224 18127 15990.45 0 18127 86623 86623 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 12.7 26.27% 2380.62 2283 2719 2382.08 2283 2719 30342 30342 0.00
multistrike 35.8 73.73% 1169.75 1142 1359 1170.23 1142 1244 41844 41844 0.00
hit 90.2 73.68% 3891.24 33 4531 3892.76 3771 3982 350875 350875 0.00
crit 32.2 26.32% 7915.42 66 9062 7920.59 7325 8440 254981 254981 0.00
 
DPS Timeline Chart
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy for {$s1=675} Fire damage and an additional $157736o1 Fire damage over {$157736d=15 seconds}.{$?s108647=false}[ Immolate critical strikes generate Burning Embers.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.989820
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.494910
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
incinerate 7294 29.2% 138.9 2.16sec 15786 11670 Direct 138.0 11303 22988 14200 24.8% 54.7 3391 6898 24.9%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 138.88 137.96 0.00 0.00 1.3527 0.0000 2192329.40 2192329.40 0.00 11669.71 11669.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 13.60 24.86% 6897.75 6619 7881 6901.29 6619 7881 93803 93803 0.00
multistrike 41.11 75.14% 3390.66 3309 3940 3391.62 3309 3557 139401 139401 0.00
hit 103.76 75.21% 11303.06 11031 13135 11306.25 11097 11544 1172758 1172758 0.00
crit 34.21 24.79% 22988.02 22062 26269 23002.36 22176 24328 786368 786368 0.00
 
DPS Timeline Chart
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:32000.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Deals {$s1=1954} Fire damage to an enemy{$?s108647=false}[ and generates Burning Embers][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.328250
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - terrorguard 6892 / 6892
doom_bolt 6892 27.6% 106.8 2.81sec 19384 7952 Direct 106.1 13671 27783 17437 26.7% 42.0 4101 8330 26.6%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.80 106.13 0.00 0.00 2.4376 0.0000 2070165.64 2070165.64 0.00 7952.33 7952.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 11.17 26.57% 8329.85 7681 10975 8337.15 0 10243 93053 93053 0.00
multistrike 30.87 73.43% 4100.85 3841 5488 4101.76 3841 4660 126590 126590 0.00
hit 77.81 73.32% 13671.21 12802 18292 13673.85 13224 14170 1063752 1063752 0.00
crit 28.32 26.68% 27783.04 25603 36583 27806.41 25891 30503 786771 786771 0.00
 
DPS Timeline Chart
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=2382} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.{$?s152107=false}[ Master gains {$s3=6} Demonic Fury. |cFF777777(Right-Click to toggle)|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.620000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Candylicious
dark_soul 3.0 120.79sec

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.35 78.15% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.66 21.85% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: dark_soul

Static Values
  • id:113858
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:8000.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.archimondes_darkness.enabled|(talent.archimondes_darkness.enabled&(charges=2|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react>6|target.health.pct<=10))
Spelldata
  • id:113858
  • name:Dark Soul: Instability
  • school:fire
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by {$113858s1=30}% for {$113858d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
 
draenic_intellect_potion 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
 
summon_terrorguard 1.0 0.00sec

Stats details: summon_terrorguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.64 81.91% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.36 18.09% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: summon_terrorguard

Static Values
  • id:112927
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:20000.0
  • cooldown:600.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic_servitude.enabled&active_enemies<5
Spelldata
  • id:112927
  • name:Summon Terrorguard
  • school:shadow
  • tooltip:
  • description:Summons a Terrorguard for {$112926d=60 seconds} to assault the target with its Doom Bolts.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
backdraft 24.7 1.7 12.4sec 11.6sec 50.03% 50.04% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_backdraft
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • backdraft_1:12.62%
  • backdraft_2:16.58%
  • backdraft_3:18.96%
  • backdraft_4:0.81%
  • backdraft_5:0.43%
  • backdraft_6:0.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate's cast time and mana cost reduced by {$s1=30}%.$?$W3<>0[ Chaos Bolt's cast time reduced by {$s3=30}%][]
  • description:{$@spelldesc117896=When you cast Conflagrate, the cast time and mana cost of your next Chaos Bolt or next three Incinerates is reduced by {$117828s1=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 25.94% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul (dark_soul) 3.0 0.0 121.0sec 120.8sec 19.27% 23.58% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • dark_soul_1:19.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:113858
  • name:Dark Soul: Instability
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by {$113858s1=30}% for {$113858d=20 seconds}.{$?s56228=false}[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
draenic_intellect_potion 2.0 0.0 239.6sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
mark_of_the_thunderlord 9.8 5.1 31.9sec 20.3sec 43.03% 43.04% 5.1(5.1)

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_mark_of_the_thunderlord
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:500.00

Stack Uptimes

  • mark_of_the_thunderlord_1:43.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159234
  • name:Mark of the Thunderlord
  • tooltip:Critical Strike increased by $w1.
  • description:Critical Strike increased by {$s1=500}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
greater_draenic_intellect_flask

Buff details

  • buff initial source:Candylicious
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Candylicious
chaos_bolt Burning Ember 24.8 24.8 1.0 1.0 69460.8
conflagrate Mana 26.4 168784.5 6400.0 6400.0 3.7
dark_soul Mana 3.0 24051.2 8000.0 8000.0 0.0
immolate Mana 20.6 395558.1 19200.0 19200.0 2.3
incinerate Mana 138.9 3694435.3 26601.2 26601.2 0.6
pet - terrorguard
doom_bolt Energy 106.8 3737.9 35.0 35.0 553.8
Resource Gains Type Count Total Average Overflow
incinerate Burning Ember 138.88 17.33 (70.83%) 0.12 0.00 0.00%
immolate Burning Ember 37.63 3.76 (15.38%) 0.10 0.00 0.00%
conflagrate Burning Ember 26.37 3.38 (13.80%) 0.13 0.00 0.00%
external_healing Health 7.89 0.00 (0.00%) 0.00 73809.17 100.00%
mp5_regen Mana 302.82 4218110.74 (100.00%) 13929.39 55666.01 1.30%
soul_leech Health 137.96 0.00 (0.00%) 0.00 293869.49 100.00%
siphon_life Health 122.38 0.00 (0.00%) 0.00 1303274.54 100.00%
pet - terrorguard
energy_regen Energy 501.62 3673.01 (100.00%) 7.32 3.99 0.11%
Resource RPS-Gain RPS-Loss
Mana 14018.35 14233.40
Burning Ember 0.08 0.08
Combat End Resource Mean Min Max
Mana 103207.30 36074.37 154087.93
Burning Ember 0.59 0.00 1.50
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.1%
felhunter-Mana Cap 1.1%
imp-Mana Cap 1.1%
succubus-Mana Cap 1.1%
voidwalker-Mana Cap 1.1%
infernal-Mana Cap 1.1%
doomguard-Mana Cap 1.1%
observer-Mana Cap 1.1%
fel_imp-Mana Cap 1.1%
shivarra-Mana Cap 1.1%
voidlord-Mana Cap 1.1%
abyssal-Mana Cap 1.1%
terrorguard-Mana Cap 1.1%
service_felhunter-Mana Cap 1.1%
service_imp-Mana Cap 1.1%
service_succubus-Mana Cap 1.1%
service_voidwalker-Mana Cap 1.1%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Candylicious Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Candylicious Damage Per Second
Count 25000
Mean 24994.50
Minimum 22647.38
Maximum 27520.82
Spread ( max - min ) 4873.44
Range [ ( max - min ) / 2 * 100% ] 9.75%
Standard Deviation 632.6998
5th Percentile 23977.14
95th Percentile 26054.12
( 95th Percentile - 5th Percentile ) 2076.97
Mean Distribution
Standard Deviation 4.0015
95.00% Confidence Intervall ( 24986.65 - 25002.34 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2461
0.1 Scale Factor Error with Delta=300 3417
0.05 Scale Factor Error with Delta=300 13669
0.01 Scale Factor Error with Delta=300 341726
Distribution Chart
DPS(e)
Sample Data Candylicious Damage Per Second (Effective)
Count 25000
Mean 24994.50
Minimum 22647.38
Maximum 27520.82
Spread ( max - min ) 4873.44
Range [ ( max - min ) / 2 * 100% ] 9.75%
Damage
Sample Data Candylicious Damage
Count 25000
Mean 5437485.04
Minimum 3933472.06
Maximum 6964407.24
Spread ( max - min ) 3030935.18
Range [ ( max - min ) / 2 * 100% ] 27.87%
DTPS
Sample Data Candylicious Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Candylicious Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Candylicious Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Candylicious Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Candylicious Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Candylicious Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data CandyliciousTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Candylicious Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet,if=!talent.demonic_servitude.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.grimoire_of_sacrifice.down)
4 0.00 summon_doomguard,if=talent.demonic_servitude.enabled&active_enemies<5
5 0.00 summon_infernal,if=talent.demonic_servitude.enabled&active_enemies>=5
6 0.00 snapshot_stats
7 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled&!talent.demonic_servitude.enabled
8 0.00 service_pet,if=talent.grimoire_of_service.enabled
9 0.00 potion,name=draenic_intellect
A 0.00 incinerate
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 potion,name=draenic_intellect,if=buff.bloodlust.react|target.health.pct<=20
C 0.00 berserking
D 0.00 blood_fury
E 0.00 arcane_torrent
F 0.00 mannoroths_fury
G 3.01 dark_soul,if=!talent.archimondes_darkness.enabled|(talent.archimondes_darkness.enabled&(charges=2|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react>6|target.health.pct<=10))
H 0.00 service_pet,if=talent.grimoire_of_service.enabled
I 0.00 summon_doomguard,if=!talent.demonic_servitude.enabled&active_enemies<5
J 0.00 summon_infernal,if=!talent.demonic_servitude.enabled&active_enemies>=5
K 0.00 run_action_list,name=single_target,if=active_enemies<6
L 0.00 run_action_list,name=aoe,if=active_enemies>=6
actions.single_target
# count action,conditions
M 0.00 havoc,target=2
N 0.00 shadowburn,if=talent.charred_remains.enabled&(burning_ember>=2.5|buff.dark_soul.up|target.time_to_die<10)
O 0.00 cataclysm,if=active_enemies>1
P 0.00 fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=action.immolate.cast_time&(cooldown.cataclysm.remains>action.immolate.cast_time|!talent.cataclysm.enabled)&active_enemies>4
Q 1.49 immolate,cycle_targets=1,if=remains<=cast_time&(cooldown.cataclysm.remains>cast_time|!talent.cataclysm.enabled)
R 0.00 cancel_buff,name=fire_and_brimstone,if=buff.fire_and_brimstone.up&dot.immolate.remains>(dot.immolate.duration*0.3)
S 0.00 shadowburn,if=buff.havoc.remains
T 0.00 chaos_bolt,if=buff.havoc.remains>cast_time&buff.havoc.stack>=3
U 1.00 conflagrate,if=charges=2
V 0.00 cataclysm
W 0.00 rain_of_fire,if=remains<=tick_time&(active_enemies>4|(buff.mannoroths_fury.up&active_enemies>2))
X 0.00 chaos_bolt,if=talent.charred_remains.enabled&active_enemies>1&target.health.pct>20
Y 0.00 chaos_bolt,if=talent.charred_remains.enabled&buff.backdraft.stack<3&burning_ember>=2.5
Z 24.93 chaos_bolt,if=buff.backdraft.stack<3&(burning_ember>=3.5|buff.dark_soul.up|(burning_ember>=3&buff.ember_master.react)|target.time_to_die<20)
a 0.00 chaos_bolt,if=buff.backdraft.stack<3&set_bonus.tier17_2pc=1&burning_ember>=2.5
b 0.00 chaos_bolt,if=buff.backdraft.stack<3&buff.archmages_greater_incandescence_int.react&buff.archmages_greater_incandescence_int.remains>cast_time
c 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time
d 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.intellect.react>7&trinket.stacking_proc.intellect.remains>=cast_time
e 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.crit.react&trinket.proc.crit.remains>cast_time
f 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.multistrike.react>=8&trinket.stacking_proc.multistrike.remains>=cast_time
g 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.multistrike.react&trinket.proc.multistrike.remains>cast_time
h 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time
i 0.00 chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time
j 0.00 fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=(dot.immolate.duration*0.3)&active_enemies>4
k 19.20 immolate,cycle_targets=1,if=remains<=(duration*0.3)
l 25.37 conflagrate
m 138.53 incinerate

Sample Sequence

0149AGQUlmmmmZZmmklmZmmmmmmmlkmmmmmmmmlmmmmkmmmZlmmmmkmlmZmmmmkmZlmmmmmlmZkmmmmmlmmZkmmmlmmmmkmGZZZlmZklmmmmmZmmlkmmmmmmmlmmkmmmmlmmmmkmmZlmmmmmklmmZmmmmlkmmmZmmlmmkmZmmlmmmBmkZmGZZlmZmklmmmZmmmmlkmZmmmmlmmZkmmmm

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember
Pre food Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember
Pre summon_terrorguard Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember
Pre potion Fluffy_Pillow 168000.0/168000: 100% mana | 1.0/4: 25% burning_ember draenic_intellect_potion
0:00.000 incinerate Fluffy_Pillow 136000.0/168000: 81% mana | 1.1/4: 28% burning_ember mark_of_the_thunderlord, draenic_intellect_potion
0:00.000 dark_soul Fluffy_Pillow 136000.0/168000: 81% mana | 1.0/4: 25% burning_ember mark_of_the_thunderlord, draenic_intellect_potion
0:00.000 immolate Fluffy_Pillow 128000.0/168000: 76% mana | 1.0/4: 25% burning_ember dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:01.278 conflagrate Fluffy_Pillow 131539.6/168000: 78% mana | 1.1/4: 28% burning_ember bloodlust, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:02.284 conflagrate Fluffy_Pillow 143039.4/168000: 85% mana | 1.3/4: 33% burning_ember bloodlust, backdraft(3), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:03.290 incinerate Fluffy_Pillow 154539.2/168000: 92% mana | 1.5/4: 38% burning_ember bloodlust, backdraft(6), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:04.295 incinerate Fluffy_Pillow 150021.3/168000: 89% mana | 1.7/4: 43% burning_ember bloodlust, backdraft(5), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:05.300 incinerate Fluffy_Pillow 145503.3/168000: 87% mana | 1.9/4: 48% burning_ember bloodlust, backdraft(4), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:06.303 incinerate Fluffy_Pillow 140949.8/168000: 84% mana | 2.1/4: 53% burning_ember bloodlust, backdraft(3), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:07.308 chaos_bolt Fluffy_Pillow 136431.8/168000: 81% mana | 2.3/4: 58% burning_ember bloodlust, backdraft(2), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:08.942 chaos_bolt Fluffy_Pillow 165505.7/168000: 99% mana | 1.3/4: 33% burning_ember bloodlust, backdraft(2), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:10.575 incinerate Fluffy_Pillow 168000.0/168000: 100% mana | 0.4/4: 10% burning_ember bloodlust, backdraft(2), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:11.580 incinerate Fluffy_Pillow 163482.0/168000: 97% mana | 0.6/4: 15% burning_ember bloodlust, backdraft, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:12.584 immolate Fluffy_Pillow 158946.3/168000: 95% mana | 0.7/4: 18% burning_ember bloodlust, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:13.587 conflagrate Fluffy_Pillow 157592.7/168000: 94% mana | 0.7/4: 18% burning_ember bloodlust, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:14.591 incinerate Fluffy_Pillow 168000.0/168000: 100% mana | 0.8/4: 20% burning_ember bloodlust, backdraft(3), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:15.596 chaos_bolt Fluffy_Pillow 163482.0/168000: 97% mana | 1.1/4: 28% burning_ember bloodlust, backdraft(2), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:17.230 incinerate Fluffy_Pillow 168000.0/168000: 100% mana | 0.1/4: 3% burning_ember bloodlust, backdraft(2), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:18.235 incinerate Fluffy_Pillow 163482.0/168000: 97% mana | 0.3/4: 8% burning_ember bloodlust, backdraft, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:19.241 incinerate Fluffy_Pillow 158981.9/168000: 95% mana | 0.5/4: 13% burning_ember bloodlust, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
0:20.548 incinerate Fluffy_Pillow 145750.6/168000: 87% mana | 0.7/4: 18% burning_ember bloodlust, mark_of_the_thunderlord
0:21.855 incinerate Fluffy_Pillow 137006.2/168000: 82% mana | 0.8/4: 20% burning_ember bloodlust, mark_of_the_thunderlord
0:23.163 incinerate Fluffy_Pillow 128279.5/168000: 76% mana | 0.9/4: 23% burning_ember bloodlust, mark_of_the_thunderlord
0:24.471 incinerate Fluffy_Pillow 119552.8/168000: 71% mana | 1.0/4: 25% burning_ember bloodlust, mark_of_the_thunderlord
0:25.778 conflagrate Fluffy_Pillow 110808.4/168000: 66% mana | 1.2/4: 30% burning_ember bloodlust
0:26.784 immolate Fluffy_Pillow 122308.2/168000: 73% mana | 1.3/4: 33% burning_ember bloodlust, backdraft(3)
0:27.788 incinerate Fluffy_Pillow 120972.5/168000: 72% mana | 1.3/4: 33% burning_ember bloodlust, backdraft(3)
0:28.792 incinerate Fluffy_Pillow 116436.7/168000: 69% mana | 1.4/4: 35% burning_ember bloodlust, backdraft(2)
0:29.796 incinerate Fluffy_Pillow 111901.0/168000: 67% mana | 1.5/4: 38% burning_ember bloodlust, backdraft
0:30.800 incinerate Fluffy_Pillow 107365.2/168000: 64% mana | 1.8/4: 45% burning_ember bloodlust
0:32.106 incinerate Fluffy_Pillow 98603.0/168000: 59% mana | 1.9/4: 48% burning_ember bloodlust
0:33.414 incinerate Fluffy_Pillow 89876.3/168000: 53% mana | 2.0/4: 50% burning_ember bloodlust
0:34.720 incinerate Fluffy_Pillow 81114.1/168000: 48% mana | 2.2/4: 55% burning_ember bloodlust
0:36.028 incinerate Fluffy_Pillow 72387.4/168000: 43% mana | 2.3/4: 58% burning_ember bloodlust
0:37.336 conflagrate Fluffy_Pillow 63660.8/168000: 38% mana | 2.4/4: 60% burning_ember bloodlust
0:38.342 incinerate Fluffy_Pillow 75160.6/168000: 45% mana | 2.6/4: 65% burning_ember bloodlust, backdraft(3)
0:39.346 incinerate Fluffy_Pillow 70624.9/168000: 42% mana | 2.8/4: 70% burning_ember bloodlust, backdraft(2)
0:40.351 incinerate Fluffy_Pillow 66106.9/168000: 39% mana | 2.9/4: 73% burning_ember bloodlust, backdraft
0:41.356 incinerate Fluffy_Pillow 57462.3/168000: 34% mana | 3.1/4: 78% burning_ember mark_of_the_thunderlord
0:43.056 immolate Fluffy_Pillow 48730.2/168000: 29% mana | 3.2/4: 80% burning_ember mark_of_the_thunderlord
0:44.331 incinerate Fluffy_Pillow 46981.1/168000: 28% mana | 3.2/4: 80% burning_ember mark_of_the_thunderlord
0:46.031 incinerate Fluffy_Pillow 38249.0/168000: 23% mana | 3.3/4: 83% burning_ember mark_of_the_thunderlord
0:47.730 Waiting 0.200 sec 29503.2/168000: 18% mana | 3.4/4: 85% burning_ember
0:47.930 incinerate Fluffy_Pillow 32240.6/168000: 19% mana | 3.4/4: 85% burning_ember
0:49.631 chaos_bolt Fluffy_Pillow 23522.1/168000: 14% mana | 3.5/4: 88% burning_ember
0:51.754 conflagrate Fluffy_Pillow 52579.6/168000: 31% mana | 2.5/4: 63% burning_ember
0:52.759 incinerate Fluffy_Pillow 59935.0/168000: 36% mana | 2.6/4: 65% burning_ember backdraft(3)
0:53.948 incinerate Fluffy_Pillow 53808.8/168000: 32% mana | 2.7/4: 68% burning_ember backdraft(2)
0:55.139 incinerate Fluffy_Pillow 47710.0/168000: 28% mana | 2.8/4: 70% burning_ember backdraft
0:56.330 incinerate Fluffy_Pillow 41611.2/168000: 25% mana | 2.9/4: 73% burning_ember
0:58.032 immolate Fluffy_Pillow 32906.5/168000: 20% mana | 3.1/4: 78% burning_ember
0:59.307 Waiting 0.100 sec 31157.4/168000: 19% mana | 3.1/4: 78% burning_ember
0:59.407 incinerate Fluffy_Pillow 32526.1/168000: 19% mana | 3.1/4: 78% burning_ember
1:01.105 Waiting 0.200 sec 23766.6/168000: 14% mana | 3.2/4: 80% burning_ember
1:01.305 conflagrate Fluffy_Pillow 26504.0/168000: 16% mana | 3.2/4: 80% burning_ember
1:02.308 incinerate Fluffy_Pillow 33832.0/168000: 20% mana | 3.4/4: 85% burning_ember backdraft(3)
1:03.498 chaos_bolt Fluffy_Pillow 27719.5/168000: 16% mana | 3.6/4: 90% burning_ember backdraft(2)
1:05.622 incinerate Fluffy_Pillow 56790.7/168000: 34% mana | 2.6/4: 65% burning_ember backdraft(2)
1:06.812 incinerate Fluffy_Pillow 50678.2/168000: 30% mana | 2.8/4: 70% burning_ember backdraft
1:08.003 incinerate Fluffy_Pillow 44579.4/168000: 27% mana | 2.9/4: 73% burning_ember
1:09.701 incinerate Fluffy_Pillow 35819.9/168000: 21% mana | 3.1/4: 78% burning_ember
1:11.401 Waiting 0.400 sec 27087.7/168000: 16% mana | 3.3/4: 83% burning_ember
1:11.801 immolate Fluffy_Pillow 32562.5/168000: 19% mana | 3.3/4: 83% burning_ember
1:13.076 Waiting 0.100 sec 30813.4/168000: 18% mana | 3.4/4: 85% burning_ember
1:13.176 incinerate Fluffy_Pillow 32182.1/168000: 19% mana | 3.4/4: 85% burning_ember
1:14.875 chaos_bolt Fluffy_Pillow 23436.3/168000: 14% mana | 3.5/4: 88% burning_ember
1:16.997 conflagrate Fluffy_Pillow 52480.1/168000: 31% mana | 2.6/4: 65% burning_ember mark_of_the_thunderlord
1:18.002 incinerate Fluffy_Pillow 59835.5/168000: 36% mana | 2.7/4: 68% burning_ember backdraft(3), mark_of_the_thunderlord
1:19.192 incinerate Fluffy_Pillow 53723.0/168000: 32% mana | 2.9/4: 73% burning_ember backdraft(2), mark_of_the_thunderlord
1:20.382 incinerate Fluffy_Pillow 47610.5/168000: 28% mana | 3.1/4: 78% burning_ember backdraft, mark_of_the_thunderlord
1:21.573 incinerate Fluffy_Pillow 41511.7/168000: 25% mana | 3.2/4: 80% burning_ember mark_of_the_thunderlord
1:23.272 incinerate Fluffy_Pillow 32765.9/168000: 20% mana | 3.3/4: 83% burning_ember mark_of_the_thunderlord
1:24.970 Waiting 0.400 sec 24006.4/168000: 14% mana | 3.4/4: 85% burning_ember mark_of_the_thunderlord
1:25.370 conflagrate Fluffy_Pillow 29481.2/168000: 18% mana | 3.4/4: 85% burning_ember mark_of_the_thunderlord
1:26.377 incinerate Fluffy_Pillow 36864.0/168000: 22% mana | 3.5/4: 88% burning_ember backdraft(3), mark_of_the_thunderlord
1:27.569 chaos_bolt Fluffy_Pillow 30778.9/168000: 18% mana | 3.6/4: 90% burning_ember backdraft(2)
1:29.692 immolate Fluffy_Pillow 59836.3/168000: 36% mana | 2.6/4: 65% burning_ember backdraft(2)
1:30.966 incinerate Fluffy_Pillow 58073.5/168000: 35% mana | 2.6/4: 65% burning_ember backdraft(2)
1:32.157 incinerate Fluffy_Pillow 51974.7/168000: 31% mana | 2.7/4: 68% burning_ember backdraft
1:33.346 incinerate Fluffy_Pillow 45848.6/168000: 27% mana | 2.8/4: 70% burning_ember
1:35.045 incinerate Fluffy_Pillow 37102.8/168000: 22% mana | 3.0/4: 75% burning_ember
1:36.744 Waiting 0.300 sec 28356.9/168000: 17% mana | 3.1/4: 78% burning_ember mark_of_the_thunderlord
1:37.044 incinerate Fluffy_Pillow 32463.0/168000: 19% mana | 3.1/4: 78% burning_ember mark_of_the_thunderlord
1:38.742 conflagrate Fluffy_Pillow 23703.5/168000: 14% mana | 3.2/4: 80% burning_ember mark_of_the_thunderlord
1:39.746 incinerate Fluffy_Pillow 31045.3/168000: 18% mana | 3.3/4: 83% burning_ember backdraft(3), mark_of_the_thunderlord
1:40.938 incinerate Fluffy_Pillow 24960.1/168000: 15% mana | 3.4/4: 85% burning_ember backdraft(2), mark_of_the_thunderlord
1:42.129 chaos_bolt Fluffy_Pillow 18861.3/168000: 11% mana | 3.5/4: 88% burning_ember backdraft, mark_of_the_thunderlord
1:44.251 immolate Fluffy_Pillow 47905.1/168000: 29% mana | 2.5/4: 63% burning_ember backdraft
1:45.526 incinerate Fluffy_Pillow 46156.0/168000: 27% mana | 2.5/4: 63% burning_ember backdraft
1:46.716 incinerate Fluffy_Pillow 40043.5/168000: 24% mana | 2.7/4: 68% burning_ember
1:48.417 Waiting 0.100 sec 31325.1/168000: 19% mana | 2.8/4: 70% burning_ember
1:48.517 incinerate Fluffy_Pillow 32693.8/168000: 19% mana | 2.8/4: 70% burning_ember
1:50.217 conflagrate Fluffy_Pillow 23961.7/168000: 14% mana | 2.9/4: 73% burning_ember
1:51.222 incinerate Fluffy_Pillow 31317.1/168000: 19% mana | 3.0/4: 75% burning_ember backdraft(3)
1:52.411 incinerate Fluffy_Pillow 25190.9/168000: 15% mana | 3.1/4: 78% burning_ember backdraft(2)
1:53.601 Waiting 0.300 sec 19078.4/168000: 11% mana | 3.2/4: 80% burning_ember backdraft
1:53.901 incinerate Fluffy_Pillow 23184.5/168000: 14% mana | 3.2/4: 80% burning_ember backdraft
1:55.091 Waiting 1.100 sec 17072.0/168000: 10% mana | 3.3/4: 83% burning_ember
1:56.191 incinerate Fluffy_Pillow 32127.7/168000: 19% mana | 3.3/4: 83% burning_ember
1:57.889 immolate Fluffy_Pillow 23368.2/168000: 14% mana | 3.4/4: 85% burning_ember
1:59.164 Waiting 0.800 sec 21619.1/168000: 13% mana | 3.4/4: 85% burning_ember
1:59.964 incinerate Fluffy_Pillow 32568.7/168000: 19% mana | 3.4/4: 85% burning_ember
2:01.664 dark_soul Fluffy_Pillow 23836.5/168000: 14% mana | 3.5/4: 88% burning_ember
2:01.664 chaos_bolt Fluffy_Pillow 15836.5/168000: 9% mana | 3.5/4: 88% burning_ember dark_soul
2:03.786 chaos_bolt Fluffy_Pillow 44880.3/168000: 27% mana | 2.5/4: 63% burning_ember dark_soul
2:05.908 chaos_bolt Fluffy_Pillow 73924.1/168000: 44% mana | 1.5/4: 38% burning_ember dark_soul
2:08.030 conflagrate Fluffy_Pillow 102967.9/168000: 61% mana | 0.6/4: 15% burning_ember dark_soul
2:09.032 incinerate Fluffy_Pillow 110282.2/168000: 66% mana | 0.9/4: 23% burning_ember backdraft(3), dark_soul
2:10.222 chaos_bolt Fluffy_Pillow 104169.7/168000: 62% mana | 1.1/4: 28% burning_ember backdraft(2), dark_soul
2:12.346 immolate Fluffy_Pillow 133240.9/168000: 79% mana | 0.1/4: 3% burning_ember backdraft(2), dark_soul
2:13.622 conflagrate Fluffy_Pillow 131505.5/168000: 78% mana | 0.1/4: 3% burning_ember backdraft(2), dark_soul
2:14.625 incinerate Fluffy_Pillow 138833.5/168000: 83% mana | 0.2/4: 5% burning_ember backdraft(5), dark_soul
2:15.815 incinerate Fluffy_Pillow 132721.0/168000: 79% mana | 0.3/4: 8% burning_ember backdraft(4), dark_soul, mark_of_the_thunderlord
2:17.007 incinerate Fluffy_Pillow 126635.9/168000: 75% mana | 0.4/4: 10% burning_ember backdraft(3), dark_soul, mark_of_the_thunderlord
2:18.198 incinerate Fluffy_Pillow 120537.1/168000: 72% mana | 0.6/4: 15% burning_ember backdraft(2), dark_soul, mark_of_the_thunderlord
2:19.389 incinerate Fluffy_Pillow 114438.3/168000: 68% mana | 0.9/4: 23% burning_ember backdraft, dark_soul, mark_of_the_thunderlord
2:20.581 chaos_bolt Fluffy_Pillow 108353.2/168000: 64% mana | 1.1/4: 28% burning_ember dark_soul, mark_of_the_thunderlord
2:22.702 incinerate Fluffy_Pillow 137383.3/168000: 82% mana | 0.1/4: 3% burning_ember mark_of_the_thunderlord
2:24.402 incinerate Fluffy_Pillow 128651.2/168000: 77% mana | 0.2/4: 5% burning_ember mark_of_the_thunderlord
2:26.099 conflagrate Fluffy_Pillow 119878.0/168000: 71% mana | 0.3/4: 8% burning_ember mark_of_the_thunderlord
2:27.105 immolate Fluffy_Pillow 127247.1/168000: 76% mana | 0.5/4: 13% burning_ember backdraft(3), mark_of_the_thunderlord
2:28.380 incinerate Fluffy_Pillow 125498.0/168000: 75% mana | 0.6/4: 15% burning_ember backdraft(3), mark_of_the_thunderlord
2:29.571 incinerate Fluffy_Pillow 119399.2/168000: 71% mana | 0.8/4: 20% burning_ember backdraft(2), mark_of_the_thunderlord
2:30.761 incinerate Fluffy_Pillow 113286.7/168000: 67% mana | 0.9/4: 23% burning_ember backdraft, mark_of_the_thunderlord
2:31.952 incinerate Fluffy_Pillow 107187.9/168000: 64% mana | 1.0/4: 25% burning_ember mark_of_the_thunderlord
2:33.652 incinerate Fluffy_Pillow 98455.7/168000: 59% mana | 1.1/4: 28% burning_ember mark_of_the_thunderlord
2:35.350 incinerate Fluffy_Pillow 89696.2/168000: 53% mana | 1.2/4: 30% burning_ember mark_of_the_thunderlord
2:37.048 incinerate Fluffy_Pillow 80936.7/168000: 48% mana | 1.4/4: 35% burning_ember mark_of_the_thunderlord
2:38.747 conflagrate Fluffy_Pillow 72190.9/168000: 43% mana | 1.5/4: 38% burning_ember mark_of_the_thunderlord
2:39.751 incinerate Fluffy_Pillow 79532.7/168000: 47% mana | 1.7/4: 43% burning_ember backdraft(3), mark_of_the_thunderlord
2:40.941 incinerate Fluffy_Pillow 73420.2/168000: 44% mana | 1.8/4: 45% burning_ember backdraft(2), mark_of_the_thunderlord
2:42.128 immolate Fluffy_Pillow 67266.6/168000: 40% mana | 1.9/4: 48% burning_ember backdraft, mark_of_the_thunderlord
2:43.402 incinerate Fluffy_Pillow 65503.8/168000: 39% mana | 2.0/4: 50% burning_ember backdraft, mark_of_the_thunderlord
2:44.593 incinerate Fluffy_Pillow 59405.0/168000: 35% mana | 2.1/4: 53% burning_ember mark_of_the_thunderlord
2:46.292 incinerate Fluffy_Pillow 50659.2/168000: 30% mana | 2.3/4: 58% burning_ember mark_of_the_thunderlord
2:47.992 incinerate Fluffy_Pillow 41927.1/168000: 25% mana | 2.4/4: 60% burning_ember mark_of_the_thunderlord
2:49.692 conflagrate Fluffy_Pillow 33194.9/168000: 20% mana | 2.5/4: 63% burning_ember mark_of_the_thunderlord
2:50.696 incinerate Fluffy_Pillow 40536.7/168000: 24% mana | 2.6/4: 65% burning_ember backdraft(3), mark_of_the_thunderlord
2:51.888 incinerate Fluffy_Pillow 34451.6/168000: 21% mana | 2.8/4: 70% burning_ember backdraft(2), mark_of_the_thunderlord
2:53.076 incinerate Fluffy_Pillow 28311.7/168000: 17% mana | 2.9/4: 73% burning_ember backdraft, mark_of_the_thunderlord
2:54.266 Waiting 0.800 sec 22199.2/168000: 13% mana | 3.0/4: 75% burning_ember mark_of_the_thunderlord
2:55.066 incinerate Fluffy_Pillow 33148.8/168000: 20% mana | 3.0/4: 75% burning_ember mark_of_the_thunderlord
2:56.765 Waiting 0.100 sec 24403.0/168000: 15% mana | 3.1/4: 78% burning_ember mark_of_the_thunderlord
2:56.865 immolate Fluffy_Pillow 25771.7/168000: 15% mana | 3.1/4: 78% burning_ember mark_of_the_thunderlord
2:58.139 Waiting 0.600 sec 24008.9/168000: 14% mana | 3.2/4: 80% burning_ember mark_of_the_thunderlord
2:58.739 incinerate Fluffy_Pillow 32221.1/168000: 19% mana | 3.2/4: 80% burning_ember mark_of_the_thunderlord
3:00.440 Waiting 0.700 sec 23502.6/168000: 14% mana | 3.4/4: 85% burning_ember mark_of_the_thunderlord
3:01.140 incinerate Fluffy_Pillow 33083.5/168000: 20% mana | 3.4/4: 85% burning_ember mark_of_the_thunderlord
3:02.840 chaos_bolt Fluffy_Pillow 24351.4/168000: 14% mana | 3.5/4: 88% burning_ember mark_of_the_thunderlord
3:04.964 conflagrate Fluffy_Pillow 53422.5/168000: 32% mana | 2.5/4: 63% burning_ember mark_of_the_thunderlord
3:05.971 incinerate Fluffy_Pillow 60805.3/168000: 36% mana | 2.6/4: 65% burning_ember backdraft(3), mark_of_the_thunderlord
3:07.162 incinerate Fluffy_Pillow 54706.5/168000: 33% mana | 2.7/4: 68% burning_ember backdraft(2)
3:08.353 incinerate Fluffy_Pillow 48607.7/168000: 29% mana | 2.9/4: 73% burning_ember backdraft
3:09.543 incinerate Fluffy_Pillow 42495.2/168000: 25% mana | 3.0/4: 75% burning_ember
3:11.244 incinerate Fluffy_Pillow 33776.8/168000: 20% mana | 3.1/4: 78% burning_ember
3:12.943 immolate Fluffy_Pillow 25031.0/168000: 15% mana | 3.2/4: 80% burning_ember
3:14.219 conflagrate Fluffy_Pillow 23295.6/168000: 14% mana | 3.2/4: 80% burning_ember
3:15.223 incinerate Fluffy_Pillow 30637.3/168000: 18% mana | 3.3/4: 83% burning_ember backdraft(3)
3:16.413 incinerate Fluffy_Pillow 24524.8/168000: 15% mana | 3.4/4: 85% burning_ember backdraft(2)
3:17.603 chaos_bolt Fluffy_Pillow 18412.3/168000: 11% mana | 3.5/4: 88% burning_ember backdraft
3:19.726 incinerate Fluffy_Pillow 47469.8/168000: 28% mana | 2.5/4: 63% burning_ember backdraft, mark_of_the_thunderlord
3:20.916 incinerate Fluffy_Pillow 41357.3/168000: 25% mana | 2.6/4: 65% burning_ember mark_of_the_thunderlord
3:22.616 incinerate Fluffy_Pillow 32625.2/168000: 19% mana | 2.7/4: 68% burning_ember mark_of_the_thunderlord
3:24.316 Waiting 0.600 sec 23893.0/168000: 14% mana | 2.8/4: 70% burning_ember mark_of_the_thunderlord
3:24.916 incinerate Fluffy_Pillow 32105.2/168000: 19% mana | 2.8/4: 70% burning_ember mark_of_the_thunderlord
3:26.616 conflagrate Fluffy_Pillow 23373.1/168000: 14% mana | 3.0/4: 75% burning_ember mark_of_the_thunderlord
3:27.621 immolate Fluffy_Pillow 30728.5/168000: 18% mana | 3.1/4: 78% burning_ember backdraft(3), mark_of_the_thunderlord
3:28.895 incinerate Fluffy_Pillow 28965.7/168000: 17% mana | 3.1/4: 78% burning_ember backdraft(3), mark_of_the_thunderlord
3:30.086 incinerate Fluffy_Pillow 22866.9/168000: 14% mana | 3.3/4: 83% burning_ember backdraft(2)
3:31.276 Waiting 0.500 sec 16754.4/168000: 10% mana | 3.4/4: 85% burning_ember backdraft
3:31.776 incinerate Fluffy_Pillow 23597.9/168000: 14% mana | 3.4/4: 85% burning_ember backdraft
3:32.967 chaos_bolt Fluffy_Pillow 17499.1/168000: 10% mana | 3.5/4: 88% burning_ember mark_of_the_thunderlord
3:35.089 incinerate Fluffy_Pillow 46542.9/168000: 28% mana | 2.5/4: 63% burning_ember mark_of_the_thunderlord
3:36.787 incinerate Fluffy_Pillow 37783.4/168000: 22% mana | 2.7/4: 68% burning_ember mark_of_the_thunderlord
3:38.487 conflagrate Fluffy_Pillow 29051.3/168000: 17% mana | 3.0/4: 75% burning_ember mark_of_the_thunderlord
3:39.493 incinerate Fluffy_Pillow 36420.4/168000: 22% mana | 3.1/4: 78% burning_ember backdraft(3), mark_of_the_thunderlord
3:40.683 incinerate Fluffy_Pillow 30307.9/168000: 18% mana | 3.2/4: 80% burning_ember backdraft(2), mark_of_the_thunderlord
3:41.873 immolate Fluffy_Pillow 24195.4/168000: 14% mana | 3.3/4: 83% burning_ember backdraft, mark_of_the_thunderlord
3:43.149 incinerate Fluffy_Pillow 22460.0/168000: 13% mana | 3.3/4: 83% burning_ember backdraft, mark_of_the_thunderlord
3:44.340 chaos_bolt Fluffy_Pillow 16361.2/168000: 10% mana | 3.5/4: 88% burning_ember mark_of_the_thunderlord
3:46.462 incinerate Fluffy_Pillow 45405.0/168000: 27% mana | 2.5/4: 63% burning_ember
3:48.161 incinerate Fluffy_Pillow 36659.1/168000: 22% mana | 2.6/4: 65% burning_ember
3:49.859 conflagrate Fluffy_Pillow 27899.6/168000: 17% mana | 2.7/4: 68% burning_ember
3:50.863 incinerate Fluffy_Pillow 35241.4/168000: 21% mana | 2.9/4: 73% burning_ember backdraft(3)
3:52.054 incinerate Fluffy_Pillow 29142.6/168000: 17% mana | 3.0/4: 75% burning_ember backdraft(2)
3:53.245 incinerate Fluffy_Pillow 23043.8/168000: 14% mana | 3.2/4: 80% burning_ember backdraft
3:54.435 potion Fluffy_Pillow 16931.3/168000: 10% mana | 3.3/4: 83% burning_ember
3:54.435 Waiting 1.200 sec 16931.3/168000: 10% mana | 3.3/4: 83% burning_ember draenic_intellect_potion
3:55.635 incinerate Fluffy_Pillow 33355.6/168000: 20% mana | 3.3/4: 83% burning_ember draenic_intellect_potion
3:57.335 immolate Fluffy_Pillow 24623.5/168000: 15% mana | 3.4/4: 85% burning_ember draenic_intellect_potion
3:58.611 chaos_bolt Fluffy_Pillow 22888.1/168000: 14% mana | 3.5/4: 88% burning_ember draenic_intellect_potion
4:00.732 incinerate Fluffy_Pillow 51918.2/168000: 31% mana | 2.5/4: 63% burning_ember draenic_intellect_potion
4:02.431 dark_soul Fluffy_Pillow 43172.4/168000: 26% mana | 2.6/4: 65% burning_ember draenic_intellect_potion
4:02.431 chaos_bolt Fluffy_Pillow 35172.4/168000: 21% mana | 2.6/4: 65% burning_ember dark_soul, draenic_intellect_potion
4:04.553 chaos_bolt Fluffy_Pillow 64216.2/168000: 38% mana | 1.6/4: 40% burning_ember dark_soul, draenic_intellect_potion
4:06.676 conflagrate Fluffy_Pillow 93273.6/168000: 56% mana | 0.6/4: 15% burning_ember dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:07.680 incinerate Fluffy_Pillow 100615.4/168000: 60% mana | 0.8/4: 20% burning_ember backdraft(3), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:08.870 chaos_bolt Fluffy_Pillow 94502.9/168000: 56% mana | 1.1/4: 28% burning_ember backdraft(2), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:10.991 incinerate Fluffy_Pillow 123533.0/168000: 74% mana | 0.2/4: 5% burning_ember backdraft(2), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:12.181 immolate Fluffy_Pillow 117420.5/168000: 70% mana | 0.4/4: 10% burning_ember backdraft, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:13.458 conflagrate Fluffy_Pillow 115698.7/168000: 69% mana | 0.4/4: 10% burning_ember backdraft, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:14.461 incinerate Fluffy_Pillow 123026.8/168000: 73% mana | 0.6/4: 15% burning_ember backdraft(4), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:15.652 incinerate Fluffy_Pillow 116928.0/168000: 70% mana | 0.8/4: 20% burning_ember backdraft(3), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:16.843 incinerate Fluffy_Pillow 110829.2/168000: 66% mana | 0.9/4: 23% burning_ember backdraft(2), dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:18.034 chaos_bolt Fluffy_Pillow 104730.4/168000: 62% mana | 1.0/4: 25% burning_ember backdraft, dark_soul, mark_of_the_thunderlord, draenic_intellect_potion
4:20.157 incinerate Fluffy_Pillow 133787.8/168000: 80% mana | 0.1/4: 3% burning_ember backdraft, dark_soul, mark_of_the_thunderlord
4:21.346 incinerate Fluffy_Pillow 127661.7/168000: 76% mana | 0.3/4: 8% burning_ember dark_soul, mark_of_the_thunderlord
4:23.044 incinerate Fluffy_Pillow 118902.2/168000: 71% mana | 0.5/4: 13% burning_ember mark_of_the_thunderlord
4:24.742 incinerate Fluffy_Pillow 110142.7/168000: 66% mana | 0.7/4: 18% burning_ember mark_of_the_thunderlord
4:26.441 conflagrate Fluffy_Pillow 101396.8/168000: 60% mana | 0.8/4: 20% burning_ember mark_of_the_thunderlord
4:27.446 immolate Fluffy_Pillow 108752.3/168000: 65% mana | 0.9/4: 23% burning_ember backdraft(3), mark_of_the_thunderlord
4:28.722 incinerate Fluffy_Pillow 107016.8/168000: 64% mana | 1.0/4: 25% burning_ember backdraft(3), mark_of_the_thunderlord
4:29.912 chaos_bolt Fluffy_Pillow 100904.4/168000: 60% mana | 1.1/4: 28% burning_ember backdraft(2), mark_of_the_thunderlord
4:32.033 incinerate Fluffy_Pillow 129934.4/168000: 77% mana | 0.1/4: 3% burning_ember backdraft(2)
4:33.225 incinerate Fluffy_Pillow 123849.3/168000: 74% mana | 0.2/4: 5% burning_ember backdraft
4:34.415 incinerate Fluffy_Pillow 117736.8/168000: 70% mana | 0.3/4: 8% burning_ember
4:36.115 incinerate Fluffy_Pillow 109004.7/168000: 65% mana | 0.4/4: 10% burning_ember
4:37.814 conflagrate Fluffy_Pillow 100258.9/168000: 60% mana | 0.6/4: 15% burning_ember
4:38.820 incinerate Fluffy_Pillow 107628.0/168000: 64% mana | 0.7/4: 18% burning_ember backdraft(3)
4:40.010 incinerate Fluffy_Pillow 101515.5/168000: 60% mana | 0.9/4: 23% burning_ember backdraft(2)
4:41.201 chaos_bolt Fluffy_Pillow 95416.7/168000: 57% mana | 1.0/4: 25% burning_ember backdraft
4:43.324 immolate Fluffy_Pillow 124474.2/168000: 74% mana | 0.0/4: 0% burning_ember backdraft
4:44.599 incinerate Fluffy_Pillow 122725.1/168000: 73% mana | 0.1/4: 3% burning_ember backdraft
4:45.791 incinerate Fluffy_Pillow 116639.9/168000: 69% mana | 0.2/4: 5% burning_ember
4:47.490 incinerate Fluffy_Pillow 107894.1/168000: 64% mana | 0.3/4: 8% burning_ember
4:49.191 incinerate Fluffy_Pillow 99175.7/168000: 59% mana | 0.4/4: 10% burning_ember

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 573 546 546
Agility 1036 987 987
Stamina 5071 4610 4191
Intellect 4308 3840 3710 (2613)
Spirit 1155 1155 1155
Health 304260 276600 0
Mana 168000 168000 0
Burning Ember 4 4 0
Spell Power 6356 5310 1470
Crit 21.45% 15.49% 1154
Haste 17.99% 12.37% 1126
Multistrike 19.82% 14.82% 978
Damage / Heal Versatility 3.60% 0.60% 78
ManaReg per Second 13687 13035 0
Mastery 47.31% 32.31% 305
Armor 671 671 661

Talents

Level
15 Dark Regeneration Soul Leech Searing Flames (Destruction Warlock)
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Horror Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Darkness Kil'jaeden's Cunning Mannoroth's Fury
100 Charred Remains Cataclysm Demonic Servitude

Profile

warlock="Candylicious"
origin="http://eu.battle.net/wow/en/character/forscherliga/Candylicious/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/213/75883733-avatar.jpg"
level=100
race=gnome
role=spell
position=back
professions=tailoring=700/inscription=189
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Vb!1200012
glyphs=siphon_life/havoc/demon_training/nightmares/verdant_spheres
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=blackrock_barbecue
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet,if=!talent.demonic_servitude.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.grimoire_of_sacrifice.down)
actions.precombat+=/summon_doomguard,if=talent.demonic_servitude.enabled&active_enemies<5
actions.precombat+=/summon_infernal,if=talent.demonic_servitude.enabled&active_enemies>=5
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled&!talent.demonic_servitude.enabled
actions.precombat+=/service_pet,if=talent.grimoire_of_service.enabled
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/incinerate

# Executed every time the actor is available.

actions=potion,name=draenic_intellect,if=buff.bloodlust.react|target.health.pct<=20
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/mannoroths_fury
actions+=/dark_soul,if=!talent.archimondes_darkness.enabled|(talent.archimondes_darkness.enabled&(charges=2|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react>6|target.health.pct<=10))
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/summon_doomguard,if=!talent.demonic_servitude.enabled&active_enemies<5
actions+=/summon_infernal,if=!talent.demonic_servitude.enabled&active_enemies>=5
actions+=/run_action_list,name=single_target,if=active_enemies<6
actions+=/run_action_list,name=aoe,if=active_enemies>=6

actions.single_target=havoc,target=2
actions.single_target+=/shadowburn,if=talent.charred_remains.enabled&(burning_ember>=2.5|buff.dark_soul.up|target.time_to_die<10)
actions.single_target+=/cataclysm,if=active_enemies>1
actions.single_target+=/fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=action.immolate.cast_time&(cooldown.cataclysm.remains>action.immolate.cast_time|!talent.cataclysm.enabled)&active_enemies>4
actions.single_target+=/immolate,cycle_targets=1,if=remains<=cast_time&(cooldown.cataclysm.remains>cast_time|!talent.cataclysm.enabled)
actions.single_target+=/cancel_buff,name=fire_and_brimstone,if=buff.fire_and_brimstone.up&dot.immolate.remains>(dot.immolate.duration*0.3)
actions.single_target+=/shadowburn,if=buff.havoc.remains
actions.single_target+=/chaos_bolt,if=buff.havoc.remains>cast_time&buff.havoc.stack>=3
actions.single_target+=/conflagrate,if=charges=2
actions.single_target+=/cataclysm
actions.single_target+=/rain_of_fire,if=remains<=tick_time&(active_enemies>4|(buff.mannoroths_fury.up&active_enemies>2))
actions.single_target+=/chaos_bolt,if=talent.charred_remains.enabled&active_enemies>1&target.health.pct>20
actions.single_target+=/chaos_bolt,if=talent.charred_remains.enabled&buff.backdraft.stack<3&burning_ember>=2.5
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&(burning_ember>=3.5|buff.dark_soul.up|(burning_ember>=3&buff.ember_master.react)|target.time_to_die<20)
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&set_bonus.tier17_2pc=1&burning_ember>=2.5
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&buff.archmages_greater_incandescence_int.react&buff.archmages_greater_incandescence_int.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.intellect.react>7&trinket.stacking_proc.intellect.remains>=cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.crit.react&trinket.proc.crit.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.stacking_proc.multistrike.react>=8&trinket.stacking_proc.multistrike.remains>=cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.multistrike.react&trinket.proc.multistrike.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time
actions.single_target+=/chaos_bolt,if=buff.backdraft.stack<3&trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time
actions.single_target+=/fire_and_brimstone,if=buff.fire_and_brimstone.down&dot.immolate.remains<=(dot.immolate.duration*0.3)&active_enemies>4
actions.single_target+=/immolate,cycle_targets=1,if=remains<=(duration*0.3)
actions.single_target+=/conflagrate
actions.single_target+=/incinerate

actions.aoe=rain_of_fire,if=remains<=tick_time
actions.aoe+=/havoc,target=2
actions.aoe+=/shadowburn,if=buff.havoc.remains
actions.aoe+=/chaos_bolt,if=buff.havoc.remains>cast_time&buff.havoc.stack>=3
actions.aoe+=/cataclysm
actions.aoe+=/fire_and_brimstone,if=buff.fire_and_brimstone.down
actions.aoe+=/immolate,if=buff.fire_and_brimstone.up&!dot.immolate.ticking
actions.aoe+=/conflagrate,if=buff.fire_and_brimstone.up&charges=2
actions.aoe+=/immolate,if=buff.fire_and_brimstone.up&dot.immolate.remains<=(dot.immolate.duration*0.3)
actions.aoe+=/chaos_bolt,if=talent.charred_remains.enabled&buff.fire_and_brimstone.up&burning_ember>=2.5
actions.aoe+=/incinerate

head=crown_of_power,id=118942
neck=odyssian_choker,id=113833,bonus_id=566,enchant=75crit
shoulders=mantle_of_volatile_ice,id=114517,bonus_id=148/560
back=cloak_of_searing_shadows,id=113847,enchant=gift_of_critical_strike
chest=robes_of_necrotic_whispers,id=113655,bonus_id=566
tabard=gnomeregan_tabard,id=45578
wrists=bracers_of_volatile_ice,id=114493,bonus_id=130
hands=meatmongers_gory_grips,id=113610
waist=cord_of_winsome_sorrows,id=119336
legs=seacursed_leggings,id=113828,bonus_id=561/566
feet=sandals_of_volatile_ice,id=114501,bonus_id=37
finger1=timeless_solium_band_of_the_archmage,id=118296,enchant=30crit
finger2=kargaths_last_link,id=113604,bonus_id=566,enchant=50crit
trinket1=quiescent_runestone,id=113859
trinket2=grandiose_power,id=114550,bonus_id=40/563,gems=50crit
main_hand=spire_of_tectus,id=113639,bonus_id=561/566,enchant=mark_of_the_thunderlord

# Gear Summary
# gear_stamina=3301
# gear_intellect=2613
# gear_spell_power=1470
# gear_crit_rating=1099
# gear_haste_rating=1126
# gear_mastery_rating=305
# gear_armor=661
# gear_multistrike_rating=978
# gear_versatility_rating=78
# gear_avoidance_rating=82
default_pet=felhunter

Dârkride

Dârkride : 22239 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
22239.3 22239.3 7.8 / 0.035% 2454.6 / 11.0% 2604.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.5 8.5 Rage 0.00% 92.3 100.0% 100%
Origin http://eu.battle.net/wow/en/character/forscherliga/Dârkride/advanced
Talents
  • 15: Double Time
  • 30: Enraged Regeneration
  • 45: Unyielding Strikes (Protection Warrior)
  • 60: Dragon Roar
  • 75: Vigilance
  • 90: Bloodbath
  • 100: Gladiator's Resolve (Protection Warrior)
  • Talent Calculator
Glyphs
  • Glyph of Enraged Speed
  • Glyph of Cleave
  • Glyph of Bull Rush
  • Glyph of Gushing Wound
  • Glyph of Bloodcurdling Shout
  • Glyph of Mystic Shout
Professions
  • mining: 700
  • blacksmithing: 666

Charts

http://0.chart.apis.google.com/chart?cht=bhg&chf=bg,s,333333&chtt=D%C3%A2rkride+Damage+Per+Execute+Time&chts=dddddd,18&chs=550x210&chd=t:22958|22903|15558|14138|8298|2466&chds=0,45917&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++22958++execute,C79C6E,0,0,15|t++22903++dragon_roar,C79C6E,1,0,15|t++15558++shield_slam,C79C6E,2,0,15|t++14138++revenge,C79C6E,3,0,15|t++8298++devastate,C79C6E,4,0,15|t++2466++auto_attack_mh,C79C6E,5,0,15& http://1.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=D%C3%A2rkride+Damage+Sources&chts=dddddd,18&chs=550x275&chd=t:20,20,18,11,9,8,6,3,2,2,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=shield_slam|devastate|heroic_strike|auto_attack_mh|deep_wounds|revenge|bloodbath|execute|dragon_roar|shattered_bleed|heroic_leap&
http://3.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=D%C3%A2rkride+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:hkorsvz158663331zzywvtrqronljjjiihgghffgfeddddddcbccbfghgjjkjlmlmpporsrpsppnnmkjkjgihgefedcdcbZbbacccacbcbbcaabcadeedffgfghggijhkkkjjjighgfdffdeedbdccabcaabbabcbabbbabbaZbbZccdcdeddefdeggfghhfhgfeefcdddbcdcbcbaabbabbcacccaccabbcbcddbdfeeggggiihjkkillkjkjhhihfggfdfedbdcbbccbcccbcdcbdcbbccbccdbddcceedefgfghhghhggihggggefffdeeccdcccddbccdbdcbbddbdcdcdddcefddgfefedbaYWUUSQO&chco=FDD017&chds=0,60&chm=h,FFF569,0,0.553648,0.4|h,C41F3B,0,0,0.4&chxt=x,y&chxl=0:|0|sec=372|1:|0|avg=22239|max=40169&chxp=1,1,55,100 Resolve Timeline Chart http://6.chart.apis.google.com/chart?cht=bvs&chf=bg,s,333333&chtt=D%C3%A2rkride+DPS+Distribution&chts=dddddd,18&chs=550x185&chg=20,20&chxs=0,FFFFFF&chd=t:1,0,0,1,3,9,10,28,39,55,119,151,217,337,459,609,792,932,1147,1278,1397,1462,1521,1545,1518,1520,1419,1291,1244,1072,896,763,704,555,486,362,296,209,170,112,89,69,28,34,11,14,10,10,2,4&chds=0,1545&chbh=5&chxt=x&chxl=0:|min=19797|avg=22239|max=24774&chxp=0,1,49,100& http://2.chart.apis.google.com/chart?cht=p&chf=bg,s,333333&chtt=D%C3%A2rkride+Spent+Time&chts=dddddd,18&chs=550x275&chd=t:52.5,29.2,13.2,3.0,2.3&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=devastate 158.1s|shield_slam 87.9s|revenge 39.7s|execute 8.9s|dragon_roar 7.0s&

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Dârkride 22239
auto_attack_mh 2463 11.1% 133.3 2.27sec 5549 2466 Direct 133.3 4466 9034 5335 19.0% 17.8 1340 2708 19.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.32 133.32 0.00 0.00 2.2505 0.0000 739787.25 1136936.20 34.93 2465.58 2465.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.40 19.12% 2707.87 2374 3417 2612.04 0 3417 9206 14148 33.68
multistrike 14.38 80.88% 1340.28 1187 1708 1341.41 1187 1708 19271 29617 34.93
hit 107.95 80.97% 4466.21 3956 5694 4469.75 4326 4673 482148 740985 34.93
crit 25.37 19.03% 9033.79 7913 11389 9042.47 8308 10262 229162 352186 34.93
 
DPS Timeline Chart
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
bloodbath 1265 5.7% 5.5 60.04sec 68608 0 Periodic 92.2 4113 0 4113 0.0% 0.0 0 0 0.0% 30.6%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.52 5.52 92.16 92.16 0.0000 1.0000 379045.54 379045.54 0.00 4112.73 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.2 100.00% 4112.71 388 11739 4122.99 3317 5259 379046 379046 0.00
 
DPS Timeline Chart
 

Action details: bloodbath

Static Values
  • id:113344
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:{$@spelldesc12292=For the next {$12292d=12 seconds}, your melee damage abilities and their multistrikes deal {$12292s1=30}% additional damage as a bleed over {$113344d=6 seconds}. While bleeding, targets move {$147531s1=50}% slower.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
deep_wounds 1963 8.8% 120.8 2.47sec 4885 0 Periodic 98.7 4828 9736 5753 18.8% 13.2 1448 2920 18.7% 98.4%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.83 120.83 98.65 98.65 0.0000 3.0000 590227.17 590227.17 0.00 1994.33 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.5 18.71% 2919.94 2567 3823 2666.89 0 3823 7197 7197 0.00
multistrike 10.7 81.29% 1448.31 1283 1912 1449.64 1283 1912 15507 15507 0.00
hit 80.1 81.15% 4827.85 4278 6372 4832.20 4636 5061 386517 386517 0.00
crit 18.6 18.85% 9736.21 8556 12744 9746.74 8861 11621 181006 181006 0.00
 
DPS Timeline Chart
 

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec. Cancelled if target reaches full health.
  • description:Your Mortal Strike, Bloodthirst, Devastate, and Thunder Clap cause the target to bleed for $115767o1 Physical damage over {$115767d=15 seconds}. This effect is cancelled if the target reaches full health.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.600000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
devastate 4368 19.6% 120.8 2.47sec 10856 8298 Direct 120.8 8731 17701 10437 19.0% 16.2 2619 5313 19.0%  

Stats details: devastate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.83 120.83 0.00 0.00 1.3083 0.0000 1311718.63 2015904.42 34.93 8297.50 8297.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 3.07 18.97% 5313.30 4652 6679 5065.85 0 6679 16286 25029 33.26
multistrike 13.09 81.03% 2618.72 2326 3339 2620.69 2326 3183 34282 52686 34.93
hit 97.85 80.98% 8731.08 7754 11131 8739.34 8422 9144 854350 1313001 34.93
crit 22.98 19.02% 17700.82 15507 22262 17707.97 16071 20117 406800 625188 34.93
 
DPS Timeline Chart
 

Action details: devastate

Static Values
  • id:20243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.unyielding_strikes.stack>0&buff.unyielding_strikes.stack<6&buff.unyielding_strikes.remains<1.5
Spelldata
  • id:20243
  • name:Devastate
  • school:physical
  • tooltip:
  • description:Deals $sw1 Physical damage, and has a {$46953s1=30}% chance to reset the cooldown on Shield Slam and cause it to generate $/10;50227s1 more Rage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
dragon_roar 537 2.4% 5.4 61.13sec 29909 22903 Direct 5.4 0 28753 28753 100.0% 0.7 0 8633 100.0%  

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.37 5.37 0.00 0.00 1.3061 0.0000 160710.70 160710.70 0.00 22903.05 22903.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.72 100.00% 8632.97 7057 10511 4521.08 0 10511 6215 6215 0.00
crit 5.37 100.00% 28752.62 23522 35038 28810.15 26693 30456 154496 154496 0.00
 
DPS Timeline Chart
 

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:
  • description:Roar explosively, dealing {$?s12712=false}[${$m1*1.25}][$m1] damage to all enemies within $A1 yards and knocking them back and down for {$118895d=500 milliseconds}. Damage ignores all armor and is always a critical strike.
 
execute 678 3.1% 6.5 7.95sec 31324 22958 Direct 6.5 25397 50858 30110 18.5% 0.9 7621 15264 18.9%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.54 6.54 0.00 0.00 1.3645 0.0000 204743.87 314659.00 34.93 22958.50 22958.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.17 18.86% 15263.72 14178 15596 2327.32 0 15596 2519 3871 5.33
multistrike 0.71 81.14% 7621.36 7089 7798 3867.82 0 7798 5412 8318 17.73
hit 5.33 81.49% 25397.41 23630 25993 25392.05 0 25993 135277 207899 34.93
crit 1.21 18.51% 50857.69 47260 51986 37045.25 0 51986 61536 94571 25.45
 
DPS Timeline Chart
 

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.sudden_death.react
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing $sw2 Physical damage{$?s23881=false}[ with your main-hand and $163558sw2 Physical damage with your off-hand][]. Only usable on enemies that have less than 20% health.{$?s146971=false}[ Successfully killing an enemy with Execute grants you {$147352s1=300 + 100.0%} rage.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
heroic_leap 78 0.4% 6.9 46.03sec 3420 0 Direct 6.9 2730 5622 3291 19.4% 0.9 821 1686 19.4%  

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.87 6.86 0.00 0.00 0.0000 0.0000 23490.94 36101.87 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.18 19.36% 1686.41 1447 2156 274.33 0 2156 298 458 5.69
multistrike 0.74 80.64% 821.26 724 1078 435.97 0 1078 605 930 18.54
hit 5.53 80.61% 2730.30 2412 3593 2730.68 2412 3593 15104 23213 34.93
crit 1.33 19.39% 5622.42 4823 7185 4345.58 0 7185 7483 11501 26.91
 
DPS Timeline Chart
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a targeted location, slamming down with destructive force to deal {$?s12712=false}[${1.2*$52174m1}][$52174m1] Physical damage to all enemies within $52174a1 yards.
 
heroic_strike 4055 18.2% 187.2 1.61sec 6505 0 Direct 187.2 4978 10190 6254 24.5% 25.0 1493 3056 24.5%  

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 187.17 187.17 0.00 0.00 0.0000 0.0000 1217516.30 1871130.31 34.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.13 24.49% 3056.04 2326 4173 3051.62 0 4173 18735 28793 34.85
multistrike 18.91 75.51% 1493.06 1163 2087 1494.35 1250 1902 28229 43384 34.93
hit 141.33 75.51% 4977.66 3876 6956 4982.03 4737 5224 703494 1081159 34.93
crit 45.83 24.49% 10189.97 7752 13911 10199.21 9294 11320 467058 717794 34.93
 
DPS Timeline Chart
 

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.shield_charge.up|(buff.unyielding_strikes.up&rage>=50-buff.unyielding_strikes.stack*5))&target.health.pct>20
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:
  • description:Instantly deals $sw2 Physical damage{$?s58366=false}[, reducing the target's movement speed by {$129923s1=50}% for {$129923d=8 seconds}][]. This ability is not on the global cooldown.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.05
 
revenge 1868 8.4% 30.2 10.09sec 18606 14138 Direct 30.2 14998 30283 17888 18.9% 4.0 4496 9080 18.9%  

Stats details: revenge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.17 30.17 0.00 0.00 1.3160 0.0000 561372.06 862740.21 34.93 14137.86 14137.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.76 18.87% 9080.39 7013 13058 4839.37 0 13058 6915 10627 18.60
multistrike 3.28 81.13% 4496.35 3507 6529 4328.74 0 6529 14726 22631 33.60
hit 24.47 81.09% 14998.39 11688 21764 15013.31 13302 16631 366968 563972 34.93
crit 5.70 18.91% 30282.91 23377 43527 30254.96 0 43527 172763 265510 34.85
 
DPS Timeline Chart
 

Action details: revenge

Static Values
  • id:6572
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:6572
  • name:Revenge
  • school:physical
  • tooltip:
  • description:Instantly attack an enemy and two additional enemies, dealing {$s1=1} damage to the primary target and {$s3=50}% damage to the secondary targets, and generating {$/10;s2=20} Rage. Your successful dodges and parries reset the cooldown on Revenge.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.520000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
shattered_bleed 410 1.8% 17.0 18.12sec 7265 0 Direct 17.0 2076 4160 2470 18.9% 2.3 623 1248 19.1%  
Periodic 96.1 796 0 796 0.0% 12.8 243 0 0.0% 31.9%

Stats details: shattered_bleed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.96 16.96 96.09 96.09 0.0000 1.0000 123193.11 123193.11 0.00 1282.13 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.43 19.08% 1247.53 1165 1281 437.57 0 1281 542 542 0.00
multistrike 1.84 80.92% 622.83 582 641 520.92 0 641 1148 1148 0.00
hit 13.75 81.09% 2076.26 1941 2135 2075.94 1941 2135 28550 28550 0.00
crit 3.21 18.91% 4159.82 3882 4270 4009.41 0 4270 13342 13342 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike 12.8 100.00% 242.62 243 243 242.62 243 243 3104 3104 0.00
hit 96.1 100.00% 796.24 0 809 796.61 765 809 76507 76507 0.00
 
DPS Timeline Chart
 

Action details: shattered_bleed

Static Values
  • id:159238
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:159238
  • name:Shattered Bleed
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2.
  • description:Inflicts {$s1=1500} Bleed damage, plus an additional $o2 damage over {$d=6 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1499.91
  • base_dd_max:1499.91
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:749.87
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shield_slam 4553 20.5% 66.9 4.52sec 20446 15558 Direct 66.9 16425 33388 19660 19.1% 8.9 4923 10011 19.1%  

Stats details: shield_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.86 66.86 0.00 0.00 1.3142 0.0000 1367110.27 2101032.62 34.93 15558.15 15558.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.71 19.12% 10010.86 7434 13842 8178.88 0 13842 17073 26239 28.52
multistrike 7.21 80.88% 4923.12 3717 6921 4924.12 0 6921 35516 54583 34.90
hit 54.11 80.93% 16425.04 12390 23069 16444.14 15360 17846 888815 1365968 34.93
crit 12.75 19.07% 33388.23 24779 46139 33417.45 24779 43725 425706 654243 34.93
 
DPS Timeline Chart
 

Action details: shield_slam

Static Values
  • id:23922
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:23922
  • name:Shield Slam
  • school:physical
  • tooltip:
  • description:Slam the target with your shield, causing ${$<shieldslam>} damage{$?s58375=false}[, dispelling 1 magical effect,][] and generating {$/10;s3=20} Rage. Critical strikes with Shield Slam cause your next Heroic Strike to cost no Rage and be a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.671200
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Dârkride
berserker_rage 9.1 34.46sec

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.11 9.11 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.11 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.enrage.down
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You go berserk, removing and granting immunity to Fear, Sap and Incapacitate effects for {$d=6 seconds}.
 
blood_craze 17.8 16.23sec

Stats details: blood_craze

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 17.78 0.00 51.09 51.09 0.0000 1.0000 0.00 137038.30 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.1 100.00% 0.00 0 0 0.00 0 0 0 137038 100.00
 
HPS Timeline Chart
 

Action details: blood_craze

Static Values
  • id:159362
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dârkride
  • harmful:false
  • if_expr:
Spelldata
  • id:159362
  • name:Blood Craze
  • school:physical
  • tooltip:
  • description:Your multistrikes from auto attacks trigger a Blood Craze. Blood Craze regenerates {$s1=3}% of your health over {$159363d=3 seconds}. When this effect is refreshed, the remaining portion is added to the new effect.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.83 83.48% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.17 16.52% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it {$?s58377=false}[and {$58377s1=2} additional nearby targets ][]for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. Generates {$/10;s2=20} Rage.
 
draenic_armor_potion 2.0 0.00sec

Stats details: draenic_armor_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156430
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156430
  • name:Draenic Armor Potion
  • school:physical
  • tooltip:Armor increased by {$s1=1500}.
  • description:Increases your bonus armor by {$s1=1500} for {$d=25 seconds}.
 
shield_charge 21.3 14.53sec

Stats details: shield_charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.26 21.26 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: shield_charge

Static Values
  • id:156321
  • school:physical
  • resource:rage
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!buff.shield_charge.up&!cooldown.shield_slam.remains)|charges=2
Spelldata
  • id:156321
  • name:Shield Charge
  • school:physical
  • tooltip:
  • description:Raise your shield and charge a short distance to your target, increasing the damage of Shield Slam, Revenge, and Heroic Strike by {$169667s1=25}% for {$169667d=7 seconds}. Maximum 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
berserker_rage 9.1 0.0 34.9sec 34.5sec 18.01% 18.03% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserker_rage_1:18.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You go berserk, removing and granting immunity to Fear, Sap and Incapacitate effects for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:30.00
  • default_chance:0.00%
blood_craze 15.0 2.8 19.4sec 16.2sec 16.53% 16.54% 2.8(2.8)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_blood_craze
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • blood_craze_1:16.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:159363
  • name:Blood Craze
  • tooltip:Regenerating $w1 health every $t1 sec.
  • description:{$@spelldesc159362=Your multistrikes from auto attacks trigger a Blood Craze. Blood Craze regenerates {$s1=3}% of your health over {$159363d=3 seconds}. When this effect is refreshed, the remaining portion is added to the new effect.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
bloodbath 5.5 0.0 60.1sec 60.0sec 21.57% 21.64% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodbath_1:21.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks and their multistrikes cause an additional {$12292s1=30}% bleed damage.
  • description:For the next {$12292d=12 seconds}, your melee damage abilities and their multistrikes deal {$12292s1=30}% additional damage as a bleed over {$113344d=6 seconds}. While bleeding, targets move {$147531s1=50}% slower.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 33.34% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
draenic_armor_potion 2.0 0.0 59.9sec 0.0sec 15.22% 15.23% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_draenic_armor_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:bonus_armor
  • amount:1500.00

Stack Uptimes

  • draenic_armor_potion_1:15.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156430
  • name:Draenic Armor Potion
  • tooltip:Armor increased by {$s1=1500}.
  • description:Increases your bonus armor by {$s1=1500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
enrage 17.8 27.0 17.3sec 6.8sec 76.80% 69.82% 27.0(27.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enrage_1:76.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Damage dealt increased by {$s2=10}%.$?$w5!=0[ Movement speed increased by $w5%.][]
  • description:{$@spelldesc13046={$?s23881=false}[Bloodthirst critical strikes][Shield Slam and Devastate critical strikes, critical blocks,] and activating Berserker Rage will Enrage you, generating ${$12880m1/10} Rage and increasing damage done by {$12880s2=10}% for {$12880d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
enraged_speed (enraged_speed) 17.8 27.0 17.3sec 6.8sec 76.80% 76.80% 27.0(27.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_enraged_speed
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enraged_speed_1:76.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58355
  • name:Glyph of Enraged Speed
  • tooltip:
  • description:While Enraged, you move {$58355s1=20}% faster.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
shield_charge 21.3 0.0 14.4sec 14.5sec 49.13% 57.10% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_shield_charge
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • shield_charge_1:49.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:169667
  • name:Shield Charge
  • tooltip:Increases damage done by your Shield Slam, Revenge, and Heroic Strike abilities by {$s1=25}%.
  • description:{$@spelldesc156321=Raise your shield and charge a short distance to your target, increasing the damage of Shield Slam, Revenge, and Heroic Strike by {$169667s1=25}% for {$169667d=7 seconds}. Maximum 2 charges.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
spirit_of_the_warlords 3.1 0.0 117.9sec 117.9sec 19.78% 19.79% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_spirit_of_the_warlords
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:crit_rating
  • amount:1396.00

Stack Uptimes

  • spirit_of_the_warlords_1:19.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162915
  • name:Spirit of the Warlords
  • tooltip:Critical strike increased by {$s1=1044}.
  • description:Critical strike increased by {$s1=1044} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
sword_and_board 36.2 0.0 8.1sec 8.1sec 15.71% 53.84% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_sword_and_board
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.00

Stack Uptimes

  • sword_and_board_1:15.71%

Trigger Attempt Success

  • trigger_pct:30.02%

Spelldata details

  • id:50227
  • name:Sword and Board
  • tooltip:Shield Slam generates $/10;50227s1 more Rage.
  • description:Your Devastate has a {$s1=50}% chance of resetting the cooldown of your Shield Slam and increasing the Rage it generates by $/10;50227s1 for {$50227d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
ultimatum 12.8 0.0 22.6sec 22.7sec 2.81% 2.83% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_ultimatum
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • ultimatum_1:2.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:122510
  • name:Ultimatum
  • tooltip:Your next Heroic Strike costs no Rage and is a critical strike.
  • description:{$@spelldesc122509=Your Shield Slam criticals make your next Heroic Strike cost no Rage and be a guaranteed critical strike.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
unyielding_strikes 16.6 81.2 18.4sec 3.1sec 92.88% 91.83% 0.0(0.0)

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_unyielding_strikes
  • max_stacks:6
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-5.00

Stack Uptimes

  • unyielding_strikes_1:13.48%
  • unyielding_strikes_2:13.22%
  • unyielding_strikes_3:12.54%
  • unyielding_strikes_4:13.48%
  • unyielding_strikes_5:13.84%
  • unyielding_strikes_6:26.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:169686
  • name:Unyielding Strikes
  • tooltip:Heroic Strike cost reduced by ${$m1/-10}.
  • description:
  • max_stacks:6
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
gladiator_stance

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_gladiator_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • gladiator_stance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156291
  • name:Gladiator Stance
  • tooltip:An offensive stance that trades all defensive prowess for increase damage dealing. Physical damage dealt increased by {$s1=20}%. Your Shield Block is replaced with Shield Charge.
  • description:A dauntless combat stance. Increases physical damage dealt by {$s1=20}%, and replaces your Shield Block with Shield Charge. You cannot change into or out of this stance during combat.
  • max_stacks:0
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%
greater_draenic_strength_flask

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_greater_draenic_strength_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stat Buff details

  • stat:strength
  • amount:250.00

Stack Uptimes

  • greater_draenic_strength_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156080
  • name:Greater Draenic Strength Flask
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
resolve

Buff details

  • buff initial source:Dârkride
  • cooldown name:buff_resolve
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • resolve_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Custom Section

Dârkride

Overall DPS

22239.27

Percentage of damage dealt to primary target

%100.00

Dps done to primary target

22239.27

DPS occuring inside of shield charge + benefiting from shield charge

6842.90

Percentage of overall damage

30.77

Resources

Resource Usage Type Count Total Average RPE APR
Dârkride
execute Rage 6.5 196.1 30.0 30.0 1044.1
heroic_strike Rage 187.2 1943.4 10.4 10.4 626.5
shield_charge Rage 21.3 425.3 20.0 20.0 0.0
Resource Gains Type Count Total Average Overflow
blood_craze Health 51.09 0.00 (0.00%) 0.00 137038.10 100.00%
external_healing Health 8.21 0.00 (0.00%) 0.00 76697.40 100.00%
charge Rage 1.00 35.00 (1.35%) 35.00 0.00 0.00%
enrage Rage 44.85 447.18 (17.23%) 9.97 1.28 0.29%
revenge Rage 30.17 599.75 (23.11%) 19.88 3.70 0.61%
shield_slam Rage 66.86 1334.71 (51.43%) 19.96 2.57 0.19%
sword_and_board Rage 36.07 178.48 (6.88%) 4.95 1.85 1.03%
Resource RPS-Gain RPS-Loss
Rage 8.62 8.52
Combat End Resource Mean Min Max
Rage 30.76 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.7%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Dârkride Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Dârkride Damage Per Second
Count 25000
Mean 22239.27
Minimum 19796.99
Maximum 24774.41
Spread ( max - min ) 4977.41
Range [ ( max - min ) / 2 * 100% ] 11.19%
Standard Deviation 632.3872
5th Percentile 21253.64
95th Percentile 23326.95
( 95th Percentile - 5th Percentile ) 2073.31
Mean Distribution
Standard Deviation 3.9996
95.00% Confidence Intervall ( 22231.43 - 22247.11 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 31
0.1% Error 3106
0.1 Scale Factor Error with Delta=300 3413
0.05 Scale Factor Error with Delta=300 13655
0.01 Scale Factor Error with Delta=300 341389
Distribution Chart
DPS(e)
Sample Data Dârkride Damage Per Second (Effective)
Count 25000
Mean 22239.27
Minimum 19796.99
Maximum 24774.41
Spread ( max - min ) 4977.41
Range [ ( max - min ) / 2 * 100% ] 11.19%
Damage
Sample Data Dârkride Damage
Count 25000
Mean 6678915.85
Minimum 4904581.21
Maximum 8564101.94
Spread ( max - min ) 3659520.72
Range [ ( max - min ) / 2 * 100% ] 27.40%
DTPS
Sample Data Dârkride Damage Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Dârkride Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Dârkride Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Dârkride Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Dârkride Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Dârkride Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data DârkrideTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Dârkride Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_strength_flask
1 0.00 food,type=blackrock_barbecue
2 0.00 stance,choose=gladiator
talent_override=bladestorm,if=raid_event.adds.count>1|desired_targets>2|(raid_event.adds.duration<10&raid_event.adds.exists) talent_override=dragon_roar,if=raid_event.adds.count>=1|desired_targets>1
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done. # Generic on-use trinket line if needed when swapping trinkets out. #actions+=/use_item,slot=trinket1,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
4 0.00 potion,name=draenic_armor
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 charge
6 1.00 auto_attack
7 0.00 call_action_list,name=movement,if=movement.distance>5
This is mostly to prevent cooldowns from being accidentally used during movement.
8 0.00 avatar
9 5.52 bloodbath
A 0.00 blood_fury,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
B 0.00 berserking,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
C 0.00 arcane_torrent,if=rage<rage.max-40
D 1.00 potion,name=draenic_armor,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up
E 21.26 shield_charge,if=(!buff.shield_charge.up&!cooldown.shield_slam.remains)|charges=2
F 9.11 berserker_rage,if=buff.enrage.down
G 6.87 heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
H 146.95 heroic_strike,if=(buff.shield_charge.up|(buff.unyielding_strikes.up&rage>=50-buff.unyielding_strikes.stack*5))&target.health.pct>20
I 40.21 heroic_strike,if=buff.ultimatum.up|rage>=rage.max-20|buff.unyielding_strikes.stack>4|target.time_to_die<10
J 0.00 call_action_list,name=single,if=active_enemies=1
K 0.00 call_action_list,name=aoe,if=active_enemies>=2
actions.single
# count action,conditions
P 19.69 devastate,if=buff.unyielding_strikes.stack>0&buff.unyielding_strikes.stack<6&buff.unyielding_strikes.remains<1.5
Q 66.86 shield_slam
R 30.17 revenge
S 0.00 execute,if=buff.sudden_death.react
T 0.00 storm_bolt
U 5.37 dragon_roar
V 6.54 execute,if=rage>60&target.health.pct<20
W 101.14 devastate

Sample Sequence

014569EFQHRHUWWQHWHGWQHWEHQHHRHWHWHQHWHWWHEHQHWHRHWQHHWQHWIIQHWHWFHREHQHWHWHQHWQHHWQHHRHWHWIQHWHWEHQHRHWHWHQGIWHQHWHQ9DHRFHPEHQHUHPHQHWHRIWHQHWEHQHWHWHQHRHPHWHQHWHWWHEHQHRHPFWHQHWQHGWHIQHRHPHWEHQHWHQHWHQHRPHWQHWE9QHHWHRHUHPHQHWHWQIRWHFHWEHQHWWHWHHQHRGHPHWHQHWWHHWEQHRHPWHQHWHIWHWHQHRWHWEHFQHWHQHWHRHWIIQIW9IWIWIQRUWHEQHWWHQHHRHPGWIQIFHWHWHWEHQHRHWWHQHWWWIIQHRHPHWEHQHWHQHWQHHRPEHQHWHWQHWIIRIWIQ9IWGIWEFQVRUQVWQIWRVEPQWQIVPIIQIRIPIVEIQIWFQIWRIWQIWIWIWIEQIRIPIWI

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 0.0/100: 0% rage
Pre food Fluffy_Pillow 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% rage draenic_armor_potion
0:00.000 charge Fluffy_Pillow 0.0/100: 0% rage draenic_armor_potion
0:00.000 auto_attack Fluffy_Pillow 35.0/100: 35% rage draenic_armor_potion
0:00.000 bloodbath Fluffy_Pillow 35.0/100: 35% rage spirit_of_the_warlords, draenic_armor_potion
0:00.000 shield_charge Fluffy_Pillow 35.0/100: 35% rage bloodbath, spirit_of_the_warlords, draenic_armor_potion
0:00.000 berserker_rage Fluffy_Pillow 15.0/100: 15% rage bloodbath, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:00.000 shield_slam Fluffy_Pillow 25.0/100: 25% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:00.000 heroic_strike Fluffy_Pillow 15.0/100: 15% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:01.365 revenge Fluffy_Pillow 15.0/100: 15% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:01.365 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:02.416 dragon_roar Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:03.466 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords, draenic_armor_potion
0:04.516 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:05.569 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodlust, berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:05.569 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodlust, berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:06.619 devastate Fluffy_Pillow 15.0/100: 15% rage bloodlust, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords, draenic_armor_potion
0:06.619 heroic_strike Fluffy_Pillow 0.0/100: 0% rage bloodlust, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3), spirit_of_the_warlords, draenic_armor_potion
0:07.666 heroic_leap Fluffy_Pillow 0.0/100: 0% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(3), spirit_of_the_warlords, draenic_armor_potion
0:07.666 devastate Fluffy_Pillow 0.0/100: 0% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(3), spirit_of_the_warlords, draenic_armor_potion
0:08.717 shield_slam Fluffy_Pillow 10.0/100: 10% rage bloodlust, bloodbath, enrage, enraged_speed, sword_and_board, unyielding_strikes(4), spirit_of_the_warlords, draenic_armor_potion
0:08.717 heroic_strike Fluffy_Pillow 25.0/100: 25% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords, draenic_armor_potion
0:09.766 devastate Fluffy_Pillow 25.0/100: 25% rage bloodlust, bloodbath, enrage, enraged_speed, unyielding_strikes(4), spirit_of_the_warlords, draenic_armor_potion
0:09.766 shield_charge Fluffy_Pillow 5.0/100: 5% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:09.766 heroic_strike Fluffy_Pillow 0.0/100: 0% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:10.817 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:10.817 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:11.867 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:11.867 revenge Fluffy_Pillow 15.0/100: 15% rage bloodlust, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:12.919 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:12.919 devastate Fluffy_Pillow 30.0/100: 30% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords, draenic_armor_potion
0:13.970 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodlust, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:13.970 devastate Fluffy_Pillow 30.0/100: 30% rage bloodlust, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:15.020 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodlust, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:15.020 shield_slam Fluffy_Pillow 30.0/100: 30% rage bloodlust, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:16.070 heroic_strike Fluffy_Pillow 50.0/100: 50% rage bloodlust, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:16.070 devastate Fluffy_Pillow 50.0/100: 50% rage bloodlust, shield_charge, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:17.120 heroic_strike Fluffy_Pillow 50.0/100: 50% rage bloodlust, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:17.120 devastate Fluffy_Pillow 50.0/100: 50% rage bloodlust, unyielding_strikes(6), spirit_of_the_warlords, draenic_armor_potion
0:18.169 devastate Fluffy_Pillow 60.0/100: 60% rage bloodlust, enrage, enraged_speed, spirit_of_the_warlords, draenic_armor_potion
0:18.169 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:19.219 shield_charge Fluffy_Pillow 45.0/100: 45% rage bloodlust, enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:19.219 heroic_strike Fluffy_Pillow 25.0/100: 25% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:19.219 shield_slam Fluffy_Pillow 0.0/100: 0% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes, spirit_of_the_warlords, draenic_armor_potion
0:20.270 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes, ultimatum
0:20.270 devastate Fluffy_Pillow 30.0/100: 30% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes
0:21.319 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:21.319 revenge Fluffy_Pillow 10.0/100: 10% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:22.370 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:22.370 devastate Fluffy_Pillow 10.0/100: 10% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:23.420 shield_slam Fluffy_Pillow 10.0/100: 10% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3)
0:23.420 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
0:24.472 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
0:24.472 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
0:25.522 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodlust, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
0:25.522 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
0:26.573 devastate Fluffy_Pillow 20.0/100: 20% rage bloodlust, enrage, enraged_speed, unyielding_strikes(4)
0:26.573 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodlust, enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
0:27.624 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodlust, sword_and_board, unyielding_strikes(5)
0:27.624 shield_slam Fluffy_Pillow 10.0/100: 10% rage bloodlust, sword_and_board, unyielding_strikes(5)
0:28.677 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodlust, unyielding_strikes(5)
0:28.677 devastate Fluffy_Pillow 30.0/100: 30% rage bloodlust, unyielding_strikes(5)
0:29.728 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodlust, unyielding_strikes(6)
0:29.728 devastate Fluffy_Pillow 30.0/100: 30% rage bloodlust, unyielding_strikes(6)
0:30.779 berserker_rage Fluffy_Pillow 30.0/100: 30% rage bloodlust, unyielding_strikes(6)
0:30.779 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodlust, berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
0:30.779 revenge Fluffy_Pillow 40.0/100: 40% rage bloodlust, berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
0:31.830 shield_charge Fluffy_Pillow 60.0/100: 60% rage bloodlust, berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
0:31.830 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodlust, berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
0:31.830 shield_slam Fluffy_Pillow 40.0/100: 40% rage bloodlust, berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
0:32.881 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodlust, berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
0:32.881 devastate Fluffy_Pillow 60.0/100: 60% rage bloodlust, berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
0:33.932 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodlust, berserker_rage, enrage, enraged_speed, shield_charge
0:33.932 devastate Fluffy_Pillow 30.0/100: 30% rage bloodlust, berserker_rage, enrage, enraged_speed, shield_charge
0:34.982 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodlust, berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes
0:34.982 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes
0:36.034 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodlust, berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes
0:36.034 devastate Fluffy_Pillow 5.0/100: 5% rage bloodlust, berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes
0:37.085 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodlust, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
0:37.085 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodlust, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:38.138 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:38.138 devastate Fluffy_Pillow 20.0/100: 20% rage bloodlust, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:39.187 shield_slam Fluffy_Pillow 30.0/100: 30% rage bloodlust, enrage, enraged_speed, sword_and_board, unyielding_strikes(3)
0:39.187 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodlust, enrage, enraged_speed, unyielding_strikes(3)
0:40.236 heroic_strike Fluffy_Pillow 40.0/100: 40% rage bloodlust, enrage, enraged_speed, unyielding_strikes(3)
0:40.236 revenge Fluffy_Pillow 25.0/100: 25% rage bloodlust, enrage, enraged_speed, unyielding_strikes(3)
0:41.286 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(3)
0:41.286 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(3)
0:42.651 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(4)
0:42.651 devastate Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(4)
0:44.016 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(5)
0:44.016 shield_slam Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, unyielding_strikes(5)
0:45.379 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(5), ultimatum
0:45.379 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(5)
0:46.744 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(6)
0:46.744 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(6)
0:46.744 shield_charge Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
0:48.106 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
0:48.106 shield_slam Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
0:49.470 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
0:49.470 revenge Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
0:50.834 heroic_strike Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, shield_charge
0:50.834 devastate Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge
0:52.200 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge, unyielding_strikes
0:52.200 devastate Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes
0:53.564 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:53.564 shield_slam Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
0:54.928 heroic_leap Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(2), ultimatum
0:54.928 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(2), ultimatum
0:54.928 devastate Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(2)
0:56.293 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(3)
0:56.293 shield_slam Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(3)
0:57.658 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(3)
0:57.658 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(3)
0:59.023 heroic_strike Fluffy_Pillow 30.0/100: 30% rage blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes(4)
0:59.023 shield_slam Fluffy_Pillow 20.0/100: 20% rage blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes(4)
1:00.387 bloodbath Fluffy_Pillow 45.0/100: 45% rage blood_craze, enrage, enraged_speed, unyielding_strikes(4)
1:00.387 potion Fluffy_Pillow 45.0/100: 45% rage bloodbath, blood_craze, enrage, enraged_speed, unyielding_strikes(4)
1:00.387 heroic_strike Fluffy_Pillow 45.0/100: 45% rage bloodbath, blood_craze, enrage, enraged_speed, unyielding_strikes(4), draenic_armor_potion
1:00.387 revenge Fluffy_Pillow 35.0/100: 35% rage bloodbath, blood_craze, enrage, enraged_speed, unyielding_strikes(4), draenic_armor_potion
1:01.751 berserker_rage Fluffy_Pillow 55.0/100: 55% rage bloodbath, unyielding_strikes(4), draenic_armor_potion
1:01.751 heroic_strike Fluffy_Pillow 65.0/100: 65% rage berserker_rage, bloodbath, enrage, enraged_speed, unyielding_strikes(4), draenic_armor_potion
1:01.751 devastate Fluffy_Pillow 55.0/100: 55% rage berserker_rage, bloodbath, enrage, enraged_speed, unyielding_strikes(4), draenic_armor_potion
1:01.751 shield_charge Fluffy_Pillow 45.0/100: 45% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), draenic_armor_potion
1:03.114 heroic_strike Fluffy_Pillow 45.0/100: 45% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), draenic_armor_potion
1:03.114 shield_slam Fluffy_Pillow 40.0/100: 40% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5), draenic_armor_potion
1:04.478 heroic_strike Fluffy_Pillow 65.0/100: 65% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:04.478 dragon_roar Fluffy_Pillow 60.0/100: 60% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:05.843 heroic_strike Fluffy_Pillow 60.0/100: 60% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:05.843 devastate Fluffy_Pillow 55.0/100: 55% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(5), draenic_armor_potion
1:07.208 heroic_strike Fluffy_Pillow 65.0/100: 65% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:07.208 shield_slam Fluffy_Pillow 65.0/100: 65% rage berserker_rage, bloodbath, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:08.572 heroic_strike Fluffy_Pillow 100.0/100: 100% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6), ultimatum, draenic_armor_potion
1:08.572 devastate Fluffy_Pillow 100.0/100: 100% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(6), draenic_armor_potion
1:09.937 heroic_strike Fluffy_Pillow 100.0/100: 100% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6), draenic_armor_potion
1:09.937 revenge Fluffy_Pillow 100.0/100: 100% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6), draenic_armor_potion
1:11.302 heroic_strike Fluffy_Pillow 100.0/100: 100% rage bloodbath, enrage, enraged_speed, draenic_armor_potion
1:11.302 devastate Fluffy_Pillow 70.0/100: 70% rage bloodbath, enrage, enraged_speed, draenic_armor_potion
1:12.668 heroic_strike Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, sword_and_board, unyielding_strikes, draenic_armor_potion
1:12.668 shield_slam Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, sword_and_board, unyielding_strikes, draenic_armor_potion
1:14.032 heroic_strike Fluffy_Pillow 80.0/100: 80% rage enrage, enraged_speed, unyielding_strikes, ultimatum, draenic_armor_potion
1:14.032 devastate Fluffy_Pillow 80.0/100: 80% rage enrage, enraged_speed, unyielding_strikes, draenic_armor_potion
1:15.032 shield_charge Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2), draenic_armor_potion
1:15.396 heroic_strike Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2), draenic_armor_potion
1:15.396 shield_slam Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2), draenic_armor_potion
1:16.760 heroic_strike Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2), draenic_armor_potion
1:16.760 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2), draenic_armor_potion
1:18.122 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3), draenic_armor_potion
1:18.122 devastate Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3), draenic_armor_potion
1:19.488 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4), draenic_armor_potion
1:19.488 shield_slam Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4), draenic_armor_potion
1:20.854 heroic_strike Fluffy_Pillow 45.0/100: 45% rage shield_charge, unyielding_strikes(4), draenic_armor_potion
1:20.854 revenge Fluffy_Pillow 35.0/100: 35% rage shield_charge, unyielding_strikes(4), draenic_armor_potion
1:22.219 heroic_strike Fluffy_Pillow 55.0/100: 55% rage unyielding_strikes(4), draenic_armor_potion
1:22.219 devastate Fluffy_Pillow 45.0/100: 45% rage unyielding_strikes(4), draenic_armor_potion
1:23.584 heroic_strike Fluffy_Pillow 45.0/100: 45% rage unyielding_strikes(5), draenic_armor_potion
1:23.584 devastate Fluffy_Pillow 40.0/100: 40% rage unyielding_strikes(5), draenic_armor_potion
1:24.951 heroic_strike Fluffy_Pillow 40.0/100: 40% rage sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:24.951 shield_slam Fluffy_Pillow 40.0/100: 40% rage sword_and_board, unyielding_strikes(6), draenic_armor_potion
1:26.316 heroic_strike Fluffy_Pillow 65.0/100: 65% rage unyielding_strikes(6)
1:26.316 devastate Fluffy_Pillow 65.0/100: 65% rage unyielding_strikes(6)
1:27.681 heroic_strike Fluffy_Pillow 75.0/100: 75% rage blood_craze, enrage, enraged_speed, unyielding_strikes(6)
1:27.681 devastate Fluffy_Pillow 75.0/100: 75% rage blood_craze, enrage, enraged_speed, unyielding_strikes(6)
1:29.047 devastate Fluffy_Pillow 75.0/100: 75% rage blood_craze, enrage, enraged_speed
1:29.047 heroic_strike Fluffy_Pillow 50.0/100: 50% rage blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes
1:30.047 shield_charge Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes
1:30.411 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes
1:30.411 shield_slam Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes
1:31.777 heroic_strike Fluffy_Pillow 30.0/100: 30% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes
1:31.777 revenge Fluffy_Pillow 5.0/100: 5% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes
1:33.139 heroic_strike Fluffy_Pillow 25.0/100: 25% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes
1:33.139 devastate Fluffy_Pillow 0.0/100: 0% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes
1:34.505 berserker_rage Fluffy_Pillow 0.0/100: 0% rage blood_craze, shield_charge, unyielding_strikes(2)
1:34.505 devastate Fluffy_Pillow 10.0/100: 10% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
1:34.505 heroic_strike Fluffy_Pillow 5.0/100: 5% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:35.870 shield_slam Fluffy_Pillow 5.0/100: 5% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:35.870 heroic_strike Fluffy_Pillow 10.0/100: 10% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
1:37.235 devastate Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(3)
1:38.600 shield_slam Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, sword_and_board, unyielding_strikes(4)
1:38.600 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(4)
1:39.964 heroic_leap Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(4)
1:39.964 devastate Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(4)
1:39.964 heroic_strike Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
1:41.329 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
1:41.329 shield_slam Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
1:42.693 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(5), ultimatum
1:42.693 revenge Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(5)
1:44.058 heroic_strike Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, unyielding_strikes(5)
1:44.058 devastate Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, unyielding_strikes(5)
1:45.422 heroic_strike Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, unyielding_strikes(6)
1:45.422 devastate Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, unyielding_strikes(6)
1:45.422 shield_charge Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
1:46.786 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
1:46.786 shield_slam Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6)
1:48.150 heroic_strike Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
1:48.150 devastate Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, shield_charge, unyielding_strikes(6)
1:49.514 heroic_strike Fluffy_Pillow 70.0/100: 70% rage shield_charge, sword_and_board
1:49.514 shield_slam Fluffy_Pillow 40.0/100: 40% rage shield_charge, sword_and_board
1:50.879 heroic_strike Fluffy_Pillow 65.0/100: 65% rage shield_charge
1:50.879 devastate Fluffy_Pillow 35.0/100: 35% rage shield_charge
1:52.242 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes
1:52.242 shield_slam Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes
1:53.607 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes
1:53.607 revenge Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes
1:54.972 devastate Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes
1:54.972 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(2)
1:56.337 devastate Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(2)
1:57.703 shield_slam Fluffy_Pillow 20.0/100: 20% rage blood_craze, enrage, enraged_speed, unyielding_strikes(3)
1:57.703 heroic_strike Fluffy_Pillow 25.0/100: 25% rage blood_craze, enrage, enraged_speed, unyielding_strikes(3)
1:59.067 devastate Fluffy_Pillow 25.0/100: 25% rage blood_craze, unyielding_strikes(3)
2:00.067 shield_charge Fluffy_Pillow 5.0/100: 5% rage blood_craze, shield_charge, sword_and_board, unyielding_strikes(4), spirit_of_the_warlords
2:00.433 bloodbath Fluffy_Pillow 5.0/100: 5% rage blood_craze, shield_charge, sword_and_board, unyielding_strikes(4), spirit_of_the_warlords
2:00.433 shield_slam Fluffy_Pillow 5.0/100: 5% rage bloodbath, blood_craze, shield_charge, sword_and_board, unyielding_strikes(4), spirit_of_the_warlords
2:00.433 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodbath, blood_craze, shield_charge, unyielding_strikes(4), spirit_of_the_warlords
2:01.797 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodbath, blood_craze, shield_charge, unyielding_strikes(4), spirit_of_the_warlords
2:01.797 devastate Fluffy_Pillow 10.0/100: 10% rage bloodbath, blood_craze, shield_charge, unyielding_strikes(4), spirit_of_the_warlords
2:03.161 heroic_strike Fluffy_Pillow 20.0/100: 20% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
2:03.161 revenge Fluffy_Pillow 15.0/100: 15% rage bloodbath, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
2:04.525 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
2:04.525 dragon_roar Fluffy_Pillow 30.0/100: 30% rage bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
2:05.889 heroic_strike Fluffy_Pillow 30.0/100: 30% rage bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
2:05.889 devastate Fluffy_Pillow 25.0/100: 25% rage bloodbath, blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(5), spirit_of_the_warlords
2:07.255 heroic_strike Fluffy_Pillow 25.0/100: 25% rage bloodbath, blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes(6), spirit_of_the_warlords
2:07.255 shield_slam Fluffy_Pillow 25.0/100: 25% rage bloodbath, blood_craze, enrage, enraged_speed, sword_and_board, unyielding_strikes(6), spirit_of_the_warlords
2:08.619 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6), ultimatum, spirit_of_the_warlords
2:08.619 devastate Fluffy_Pillow 60.0/100: 60% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
2:09.984 heroic_strike Fluffy_Pillow 60.0/100: 60% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
2:09.984 devastate Fluffy_Pillow 60.0/100: 60% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
2:11.349 shield_slam Fluffy_Pillow 60.0/100: 60% rage bloodbath, enrage, enraged_speed, sword_and_board, spirit_of_the_warlords
2:11.349 heroic_strike Fluffy_Pillow 55.0/100: 55% rage bloodbath, enrage, enraged_speed, spirit_of_the_warlords
2:12.714 revenge Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, spirit_of_the_warlords
2:14.079 devastate Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed, spirit_of_the_warlords
2:14.079 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
2:15.443 berserker_rage Fluffy_Pillow 50.0/100: 50% rage unyielding_strikes, spirit_of_the_warlords
2:15.443 heroic_strike Fluffy_Pillow 60.0/100: 60% rage berserker_rage, enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
2:15.443 devastate Fluffy_Pillow 35.0/100: 35% rage berserker_rage, enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
2:16.808 shield_charge Fluffy_Pillow 45.0/100: 45% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(2), spirit_of_the_warlords
2:16.808 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:16.808 shield_slam Fluffy_Pillow 5.0/100: 5% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:18.172 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:18.172 devastate Fluffy_Pillow 5.0/100: 5% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2), spirit_of_the_warlords
2:19.536 devastate Fluffy_Pillow 5.0/100: 5% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(3), spirit_of_the_warlords
2:19.536 heroic_strike Fluffy_Pillow 5.0/100: 5% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(4), spirit_of_the_warlords
2:20.900 devastate Fluffy_Pillow 5.0/100: 5% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:20.900 heroic_strike Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(5)
2:22.263 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
2:22.263 shield_slam Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
2:23.628 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
2:23.628 revenge Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
2:24.991 heroic_leap Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes(5)
2:24.991 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes(5)
2:24.991 devastate Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(5)
2:26.356 heroic_strike Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(6)
2:26.356 devastate Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(6)
2:27.720 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(6)
2:27.720 shield_slam Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(6)
2:29.083 heroic_strike Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, unyielding_strikes(6)
2:29.083 devastate Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed, unyielding_strikes(6)
2:30.448 devastate Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed
2:30.448 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes
2:31.810 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes
2:31.810 devastate Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes
2:31.810 shield_charge Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
2:33.176 shield_slam Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
2:33.176 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
2:34.539 revenge Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
2:34.539 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
2:35.905 devastate Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
2:37.270 devastate Fluffy_Pillow 10.0/100: 10% rage shield_charge, unyielding_strikes(3)
2:37.270 heroic_strike Fluffy_Pillow 0.0/100: 0% rage shield_charge, sword_and_board, unyielding_strikes(4)
2:38.635 shield_slam Fluffy_Pillow 0.0/100: 0% rage shield_charge, sword_and_board, unyielding_strikes(4)
2:38.635 heroic_strike Fluffy_Pillow 15.0/100: 15% rage shield_charge, unyielding_strikes(4)
2:39.999 devastate Fluffy_Pillow 15.0/100: 15% rage unyielding_strikes(4)
2:39.999 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(5)
2:41.364 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(5)
2:41.364 devastate Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, unyielding_strikes(5)
2:42.727 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(6)
2:42.727 devastate Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(6)
2:44.093 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(6)
2:44.093 shield_slam Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(6)
2:45.457 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(6)
2:45.457 revenge Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(6)
2:46.821 devastate Fluffy_Pillow 65.0/100: 65% rage enrage, enraged_speed
2:46.821 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes
2:48.186 devastate Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes
2:48.186 shield_charge Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
2:48.186 heroic_strike Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
2:49.551 berserker_rage Fluffy_Pillow 0.0/100: 0% rage shield_charge, sword_and_board, unyielding_strikes(2)
2:49.551 shield_slam Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
2:49.551 heroic_strike Fluffy_Pillow 15.0/100: 15% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
2:50.916 devastate Fluffy_Pillow 15.0/100: 15% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(2)
2:50.916 heroic_strike Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3)
2:52.280 shield_slam Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3)
2:52.280 heroic_strike Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
2:53.647 devastate Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(3)
2:53.647 heroic_strike Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:55.009 revenge Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:55.009 heroic_strike Fluffy_Pillow 10.0/100: 10% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(4)
2:56.374 devastate Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, unyielding_strikes(4)
2:56.374 heroic_strike Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, unyielding_strikes(5)
2:57.739 heroic_strike Fluffy_Pillow 5.0/100: 5% rage unyielding_strikes(5)
2:57.739 shield_slam Fluffy_Pillow 0.0/100: 0% rage unyielding_strikes(5)
2:59.103 heroic_strike Fluffy_Pillow 20.0/100: 20% rage unyielding_strikes(5)
2:59.103 devastate Fluffy_Pillow 15.0/100: 15% rage unyielding_strikes(5)
3:00.467 bloodbath Fluffy_Pillow 15.0/100: 15% rage unyielding_strikes(6)
3:00.467 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodbath, unyielding_strikes(6)
3:00.467 devastate Fluffy_Pillow 15.0/100: 15% rage bloodbath, unyielding_strikes(6)
3:01.831 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodbath, unyielding_strikes(6)
3:01.831 devastate Fluffy_Pillow 15.0/100: 15% rage bloodbath, unyielding_strikes(6)
3:03.195 heroic_strike Fluffy_Pillow 15.0/100: 15% rage bloodbath, sword_and_board, unyielding_strikes(6)
3:03.195 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodbath, sword_and_board, unyielding_strikes(6)
3:04.559 revenge Fluffy_Pillow 40.0/100: 40% rage bloodbath
3:05.924 dragon_roar Fluffy_Pillow 60.0/100: 60% rage bloodbath
3:07.288 devastate Fluffy_Pillow 60.0/100: 60% rage bloodbath
3:07.288 heroic_strike Fluffy_Pillow 35.0/100: 35% rage bloodbath, unyielding_strikes
3:08.654 shield_charge Fluffy_Pillow 35.0/100: 35% rage bloodbath, blood_craze, unyielding_strikes
3:08.654 shield_slam Fluffy_Pillow 15.0/100: 15% rage bloodbath, blood_craze, shield_charge, unyielding_strikes
3:08.654 heroic_strike Fluffy_Pillow 10.0/100: 10% rage bloodbath, blood_craze, shield_charge, unyielding_strikes
3:10.019 devastate Fluffy_Pillow 10.0/100: 10% rage bloodbath, blood_craze, shield_charge, unyielding_strikes
3:11.383 devastate Fluffy_Pillow 10.0/100: 10% rage bloodbath, shield_charge, unyielding_strikes(2)
3:11.383 heroic_strike Fluffy_Pillow 5.0/100: 5% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3)
3:12.747 shield_slam Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(3)
3:12.747 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
3:14.113 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
3:14.113 revenge Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
3:15.477 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
3:15.477 devastate Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
3:16.842 heroic_leap Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, unyielding_strikes(4)
3:16.842 devastate Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, unyielding_strikes(4)
3:16.842 heroic_strike Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, unyielding_strikes(5)
3:18.205 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, unyielding_strikes(5)
3:18.205 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, unyielding_strikes(5)
3:19.567 berserker_rage Fluffy_Pillow 15.0/100: 15% rage unyielding_strikes(5)
3:19.567 heroic_strike Fluffy_Pillow 25.0/100: 25% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(5)
3:19.567 devastate Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(5)
3:20.930 heroic_strike Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
3:20.930 devastate Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
3:22.295 heroic_strike Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
3:22.295 devastate Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
3:23.660 shield_charge Fluffy_Pillow 20.0/100: 20% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(6)
3:23.660 heroic_strike Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:23.660 shield_slam Fluffy_Pillow 0.0/100: 0% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
3:25.027 heroic_strike Fluffy_Pillow 30.0/100: 30% rage berserker_rage, enrage, enraged_speed, shield_charge, ultimatum
3:25.027 revenge Fluffy_Pillow 30.0/100: 30% rage berserker_rage, enrage, enraged_speed, shield_charge
3:26.393 heroic_strike Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, shield_charge
3:26.393 devastate Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge
3:27.757 devastate Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes
3:27.757 heroic_strike Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:29.121 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:29.121 heroic_strike Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:30.487 devastate Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:31.853 devastate Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, unyielding_strikes(3)
3:33.216 devastate Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, unyielding_strikes(4)
3:33.216 heroic_strike Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
3:34.579 heroic_strike Fluffy_Pillow 5.0/100: 5% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
3:34.579 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
3:35.944 heroic_strike Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, unyielding_strikes(5)
3:35.944 revenge Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, unyielding_strikes(5)
3:37.309 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes(5)
3:37.309 devastate Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, unyielding_strikes(5)
3:38.674 heroic_strike Fluffy_Pillow 35.0/100: 35% rage unyielding_strikes(6)
3:38.674 devastate Fluffy_Pillow 35.0/100: 35% rage unyielding_strikes(6)
3:40.039 shield_charge Fluffy_Pillow 35.0/100: 35% rage unyielding_strikes(6)
3:40.039 heroic_strike Fluffy_Pillow 15.0/100: 15% rage shield_charge, unyielding_strikes(6)
3:40.039 shield_slam Fluffy_Pillow 15.0/100: 15% rage shield_charge, unyielding_strikes(6)
3:41.405 heroic_strike Fluffy_Pillow 35.0/100: 35% rage shield_charge, unyielding_strikes(6)
3:41.405 devastate Fluffy_Pillow 35.0/100: 35% rage shield_charge, unyielding_strikes(6)
3:42.769 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, sword_and_board
3:42.769 shield_slam Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, sword_and_board
3:44.134 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge
3:44.134 devastate Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge
3:45.499 shield_slam Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes
3:45.499 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, unyielding_strikes
3:46.864 heroic_strike Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, unyielding_strikes
3:46.864 revenge Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes
3:48.227 devastate Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes
3:48.227 shield_charge Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
3:48.227 heroic_strike Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
3:49.592 shield_slam Fluffy_Pillow 10.0/100: 10% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(2)
3:49.592 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:50.957 devastate Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
3:50.957 heroic_strike Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
3:52.320 devastate Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, unyielding_strikes(3)
3:53.685 shield_slam Fluffy_Pillow 0.0/100: 0% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
3:53.685 heroic_strike Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
3:55.050 devastate Fluffy_Pillow 15.0/100: 15% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
3:55.050 heroic_strike Fluffy_Pillow 20.0/100: 20% rage enrage, enraged_speed, shield_charge, unyielding_strikes(5)
3:56.413 heroic_strike Fluffy_Pillow 20.0/100: 20% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords
3:56.413 revenge Fluffy_Pillow 15.0/100: 15% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords
3:57.777 heroic_strike Fluffy_Pillow 35.0/100: 35% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords
3:57.777 devastate Fluffy_Pillow 30.0/100: 30% rage blood_craze, enrage, enraged_speed, unyielding_strikes(5), spirit_of_the_warlords
3:59.141 heroic_strike Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
3:59.141 shield_slam Fluffy_Pillow 30.0/100: 30% rage enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
4:00.507 bloodbath Fluffy_Pillow 50.0/100: 50% rage enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
4:00.507 heroic_strike Fluffy_Pillow 50.0/100: 50% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
4:00.507 devastate Fluffy_Pillow 50.0/100: 50% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
4:01.873 heroic_leap Fluffy_Pillow 50.0/100: 50% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
4:01.873 heroic_strike Fluffy_Pillow 50.0/100: 50% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
4:01.873 devastate Fluffy_Pillow 50.0/100: 50% rage bloodbath, enrage, enraged_speed, unyielding_strikes(6), spirit_of_the_warlords
4:01.873 shield_charge Fluffy_Pillow 30.0/100: 30% rage bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(6), spirit_of_the_warlords
4:03.237 berserker_rage Fluffy_Pillow 30.0/100: 30% rage bloodbath, shield_charge, sword_and_board, spirit_of_the_warlords
4:03.237 shield_slam Fluffy_Pillow 40.0/100: 40% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, sword_and_board, spirit_of_the_warlords
4:04.600 execute Fluffy_Pillow 65.0/100: 65% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords
4:05.964 revenge Fluffy_Pillow 35.0/100: 35% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords
4:07.330 dragon_roar Fluffy_Pillow 55.0/100: 55% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords
4:08.694 shield_slam Fluffy_Pillow 55.0/100: 55% rage berserker_rage, bloodbath, enrage, enraged_speed, shield_charge, spirit_of_the_warlords
4:10.059 execute Fluffy_Pillow 75.0/100: 75% rage bloodbath, enrage, enraged_speed, spirit_of_the_warlords
4:11.423 devastate Fluffy_Pillow 45.0/100: 45% rage bloodbath, spirit_of_the_warlords
4:12.786 shield_slam Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, sword_and_board, unyielding_strikes, spirit_of_the_warlords
4:12.786 heroic_strike Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
4:14.150 devastate Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes, spirit_of_the_warlords
4:15.515 revenge Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes(2)
4:16.879 execute Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed, unyielding_strikes(2)
4:18.241 shield_charge Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, unyielding_strikes(2)
4:18.241 devastate Fluffy_Pillow 25.0/100: 25% rage enrage, enraged_speed, shield_charge, unyielding_strikes(2)
4:19.606 shield_slam Fluffy_Pillow 25.0/100: 25% rage shield_charge, sword_and_board, unyielding_strikes(3)
4:20.970 devastate Fluffy_Pillow 50.0/100: 50% rage shield_charge, unyielding_strikes(3)
4:22.335 shield_slam Fluffy_Pillow 60.0/100: 60% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(4)
4:22.335 heroic_strike Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:23.702 execute Fluffy_Pillow 75.0/100: 75% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:25.067 devastate Fluffy_Pillow 45.0/100: 45% rage enrage, enraged_speed, shield_charge, unyielding_strikes(4)
4:25.067 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, shield_charge, sword_and_board, unyielding_strikes(5)
4:26.432 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
4:26.432 shield_slam Fluffy_Pillow 35.0/100: 35% rage enrage, enraged_speed, sword_and_board, unyielding_strikes(5)
4:27.795 heroic_strike Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, unyielding_strikes(5), ultimatum
4:27.795 revenge Fluffy_Pillow 70.0/100: 70% rage enrage, enraged_speed, unyielding_strikes(5)
4:29.159 heroic_strike Fluffy_Pillow 90.0/100: 90% rage enrage, enraged_speed, unyielding_strikes(5)
4:29.159 devastate Fluffy_Pillow 85.0/100: 85% rage enrage, enraged_speed, unyielding_strikes(5)
4:30.524 heroic_strike Fluffy_Pillow 85.0/100: 85% rage enrage, enraged_speed, unyielding_strikes(6)
4:30.524 execute Fluffy_Pillow 85.0/100: 85% rage enrage, enraged_speed, unyielding_strikes(6)
4:31.888 shield_charge Fluffy_Pillow 55.0/100: 55% rage blood_craze, enrage, enraged_speed, unyielding_strikes(6)
4:31.888 heroic_strike Fluffy_Pillow 35.0/100: 35% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:31.888 shield_slam Fluffy_Pillow 35.0/100: 35% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:33.252 heroic_strike Fluffy_Pillow 55.0/100: 55% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:33.252 devastate Fluffy_Pillow 55.0/100: 55% rage blood_craze, enrage, enraged_speed, shield_charge, unyielding_strikes(6)
4:34.617 berserker_rage Fluffy_Pillow 55.0/100: 55% rage blood_craze, shield_charge, sword_and_board
4:34.617 shield_slam Fluffy_Pillow 65.0/100: 65% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge, sword_and_board
4:34.617 heroic_strike Fluffy_Pillow 60.0/100: 60% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge
4:35.981 devastate Fluffy_Pillow 60.0/100: 60% rage berserker_rage, blood_craze, enrage, enraged_speed, shield_charge
4:37.345 revenge Fluffy_Pillow 60.0/100: 60% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes
4:37.345 heroic_strike Fluffy_Pillow 55.0/100: 55% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes
4:38.709 devastate Fluffy_Pillow 55.0/100: 55% rage berserker_rage, enrage, enraged_speed, shield_charge, unyielding_strikes
4:40.074 shield_slam Fluffy_Pillow 55.0/100: 55% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(2)
4:40.274 heroic_strike Fluffy_Pillow 55.0/100: 55% rage berserker_rage, enrage, enraged_speed, unyielding_strikes(2)
4:41.441 devastate Fluffy_Pillow 55.0/100: 55% rage enrage, enraged_speed, unyielding_strikes(2)
4:41.641 heroic_strike Fluffy_Pillow 40.0/100: 40% rage enrage, enraged_speed, unyielding_strikes(3)
4:42.806 devastate Fluffy_Pillow 40.0/100: 40% rage unyielding_strikes(3)
4:43.006 heroic_strike Fluffy_Pillow 30.0/100: 30% rage unyielding_strikes(4)
4:44.171 devastate Fluffy_Pillow 30.0/100: 30% rage unyielding_strikes(4)
4:44.371 heroic_strike Fluffy_Pillow 25.0/100: 25% rage unyielding_strikes(5)
4:45.537 shield_charge Fluffy_Pillow 25.0/100: 25% rage unyielding_strikes(5)
4:45.537 shield_slam Fluffy_Pillow 5.0/100: 5% rage shield_charge, unyielding_strikes(5)
4:45.737 heroic_strike Fluffy_Pillow 20.0/100: 20% rage shield_charge, unyielding_strikes(5)
4:46.902 revenge Fluffy_Pillow 20.0/100: 20% rage shield_charge, unyielding_strikes(5)
4:47.102 heroic_strike Fluffy_Pillow 35.0/100: 35% rage shield_charge, unyielding_strikes(5)
4:48.267 devastate Fluffy_Pillow 35.0/100: 35% rage shield_charge, unyielding_strikes(5)
4:48.467 heroic_strike Fluffy_Pillow 35.0/100: 35% rage shield_charge, unyielding_strikes(6)
4:49.630 devastate Fluffy_Pillow 35.0/100: 35% rage blood_craze, shield_charge, unyielding_strikes(6)
4:49.830 heroic_strike Fluffy_Pillow 35.0/100: 35% rage blood_craze, shield_charge, unyielding_strikes(6)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4129 3683 3683 (1596)
Agility 933 889 889
Stamina 4312 3920 3778
Intellect 746 711 711
Spirit 679 679 679
Health 258720 235200 0
Rage 100 100 0
Crit 19.49% 13.58% 944
Haste 10.23% 4.98% 498
Multistrike 6.68% 1.68% 111
Damage / Heal Versatility 7.83% 4.83% 628
Attack Power 5508 4351 0
Mastery 30.10% 22.24% 751
Armor 2781 2781 2675
Bonus Armor 106 106 106

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Heavy Repercussions (Protection Warrior) Sudden Death Unyielding Strikes (Protection Warrior)
60 Storm Bolt Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Bladestorm
100 Anger Management Ravager Gladiator's Resolve (Protection Warrior)

Profile

warrior="Dârkride"
origin="http://eu.battle.net/wow/en/character/forscherliga/Dârkride/advanced"
thumbnail="http://eu.battle.net/static-render/eu/forscherliga/237/36647661-avatar.jpg"
level=100
race=human
role=attack
position=back
professions=blacksmithing=666/mining=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Zb!1022212
glyphs=enraged_speed/cleave/bull_rush/gushing_wound/bloodcurdling_shout/mystic_shout
spec=protection

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_strength_flask
actions.precombat+=/food,type=blackrock_barbecue
#
talent_override=bladestorm,if=raid_event.adds.count>1|desired_targets>2|(raid_event.adds.duration<10&raid_event.adds.exists)
talent_override=dragon_roar,if=raid_event.adds.count>=1|desired_targets>1
actions.precombat+=/stance,choose=gladiator
# Snapshot raid buffed stats before combat begins and pre-potting is done.
# Generic on-use trinket line if needed when swapping trinkets out.
#actions+=/use_item,slot=trinket1,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_armor

# Executed every time the actor is available.

actions=charge
actions+=/auto_attack
# This is mostly to prevent cooldowns from being accidentally used during movement.
actions+=/call_action_list,name=movement,if=movement.distance>5
actions+=/avatar
actions+=/bloodbath
actions+=/blood_fury,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
actions+=/berserking,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up|target.time_to_die<10
actions+=/arcane_torrent,if=rage<rage.max-40
actions+=/potion,name=draenic_armor,if=buff.bloodbath.up|buff.avatar.up|buff.shield_charge.up
actions+=/shield_charge,if=(!buff.shield_charge.up&!cooldown.shield_slam.remains)|charges=2
actions+=/berserker_rage,if=buff.enrage.down
actions+=/heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
actions+=/heroic_strike,if=(buff.shield_charge.up|(buff.unyielding_strikes.up&rage>=50-buff.unyielding_strikes.stack*5))&target.health.pct>20
actions+=/heroic_strike,if=buff.ultimatum.up|rage>=rage.max-20|buff.unyielding_strikes.stack>4|target.time_to_die<10
actions+=/call_action_list,name=single,if=active_enemies=1
actions+=/call_action_list,name=aoe,if=active_enemies>=2

actions.movement=heroic_leap
actions.movement+=/shield_charge
# May as well throw storm bolt if we can.
actions.movement+=/storm_bolt
actions.movement+=/heroic_throw

actions.single=devastate,if=buff.unyielding_strikes.stack>0&buff.unyielding_strikes.stack<6&buff.unyielding_strikes.remains<1.5
actions.single+=/shield_slam
actions.single+=/revenge
actions.single+=/execute,if=buff.sudden_death.react
actions.single+=/storm_bolt
actions.single+=/dragon_roar
actions.single+=/execute,if=rage>60&target.health.pct<20
actions.single+=/devastate

actions.aoe=revenge
actions.aoe+=/shield_slam
actions.aoe+=/dragon_roar,if=(buff.bloodbath.up|cooldown.bloodbath.remains>10)|!talent.bloodbath.enabled
actions.aoe+=/storm_bolt,if=(buff.bloodbath.up|cooldown.bloodbath.remains>7)|!talent.bloodbath.enabled
actions.aoe+=/thunder_clap,cycle_targets=1,if=dot.deep_wounds.remains<3&active_enemies>4
actions.aoe+=/bladestorm,if=buff.shield_charge.down
actions.aoe+=/execute,if=buff.sudden_death.react
actions.aoe+=/thunder_clap,if=active_enemies>6
actions.aoe+=/devastate,cycle_targets=1,if=dot.deep_wounds.remains<5&cooldown.shield_slam.remains>execute_time*0.4
actions.aoe+=/devastate,if=cooldown.shield_slam.remains>execute_time*0.4

head=casque_of_the_iron_bomber,id=113600
neck=flesh_beetle_brooch,id=109968,bonus_id=524,enchant=40crit
shoulders=verdant_plate_spaulders,id=109944,bonus_id=524
back=milenahs_intricate_cloak,id=119345,enchant=100crit
chest=gutcrusher_chestplate,id=109895,bonus_id=499/523/524,gems=35crit
shirt=antisepticsoaked_dressing,id=44694
wrists=verdant_plate_wristguards,id=109877,bonus_id=523/524,gems=35crit
hands=gauntlets_of_the_heavy_hand,id=113632,bonus_id=563,gems=35crit
waist=ripswallow_plate_belt,id=119337,bonus_id=560
legs=truesteel_greaves,id=114234,bonus_id=94/525/533
feet=entrail_squishers,id=113633
finger1=timeless_solium_band_of_the_bulwark,id=118298
finger2=knucklebone_of_lodronar,id=109772,bonus_id=524,enchant=30mastery
trinket1=mote_of_corruption,id=110010,bonus_id=524
trinket2=skull_of_war,id=112318,bonus_id=525/529
main_hand=tharbeks_brutal_posessor,id=118726,bonus_id=524,enchant=mark_of_the_shattered_hand
off_hand=ogre_dinner_plate,id=110044,bonus_id=524

# Gear Summary
# gear_strength=2228
# gear_stamina=2844
# gear_crit_rating=944
# gear_haste_rating=498
# gear_mastery_rating=715
# gear_armor=2675
# gear_bonus_armor=106
# gear_multistrike_rating=111
# gear_versatility_rating=528

Simulation & Raid Information

Iterations: 25004
Threads: 4
Confidence: 95.00%
Fight Length: 228 - 373 ( 300.9 )

Performance:

Total Events Processed: 1113403769
Max Event Queue: 400
Sim Seconds: 7523689
CPU Seconds: 566.1030
Physical Seconds: 566.1030
Speed Up: 13290

Settings:

World Lag: 50 ms ( stddev = 5 ms )
Queue Lag: 5 ms ( stddev = 1 ms )
Simulation Length
Sample Data Simulation Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
Standard Deviation 39.4005
5th Percentile 241.97
95th Percentile 363.15
( 95th Percentile - 5th Percentile ) 121.18
Mean Distribution
Standard Deviation 0.2492
95.00% Confidence Intervall ( 300.41 - 301.39 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 658
0.1% Error 65865
0.1 Scale Factor Error with Delta=300 13
0.05 Scale Factor Error with Delta=300 53
0.01 Scale Factor Error with Delta=300 1325
Distribution Chart
Timeline Distribution Chart Gear Chart Raid Downtime Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Ciaran Ciaran celestial_alignment 112071 0 0 0.40 0 0 2.0 2.0 13.4% 0.0% 0.0% 0.0% 181.75sec 0 300.90sec
Ciaran Ciaran draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Ciaran Ciaran force_of_nature 33831 0 0 3.34 0 0 16.8 16.8 12.5% 0.0% 0.0% 0.0% 19.73sec 0 300.90sec
Ciaran Ciaran moonfire 8921 51448 171 1.80 4799 9090 9.0 9.0 12.7% 0.0% 0.0% 0.0% 34.97sec 758768 300.90sec
Ciaran Ciaran moonfire ticks -8921 707320 2358 35.13 3324 6752 9.0 175.7 12.9% 0.0% 0.0% 0.0% 34.97sec 758768 300.90sec
Ciaran Ciaran moonkin_form 24858 0 0 0.20 0 0 1.0 1.0 10.5% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Ciaran Ciaran shattered_bleed 159238 33964 113 3.47 1616 3249 17.4 17.4 12.8% 0.0% 0.0% 0.0% 17.67sec 115468 300.90sec
Ciaran Ciaran shattered_bleed ticks -159238 81504 272 19.45 783 0 17.4 97.3 0.0% 0.0% 0.0% 0.0% 17.67sec 115468 300.90sec
Ciaran Ciaran starfire 2912 2032121 6753 10.50 31718 65069 52.7 52.7 13.2% 0.0% 0.0% 0.0% 5.61sec 2032121 300.90sec
Ciaran Ciaran starsurge 78674 1185776 3941 6.09 31955 65368 30.7 30.5 13.1% 0.0% 0.0% 0.0% 10.00sec 1185776 300.90sec
Ciaran Ciaran sunfire 93402 80886 269 1.90 7024 14245 9.5 9.5 12.6% 0.0% 0.0% 0.0% 32.33sec 706291 300.90sec
Ciaran Ciaran sunfire ticks -93402 625405 2085 33.83 3049 6225 9.5 169.2 12.9% 0.0% 0.0% 0.0% 32.33sec 706291 300.90sec
Ciaran Ciaran wrath 5176 1231016 4091 12.21 16748 33554 61.6 61.2 12.3% 0.0% 0.0% 0.0% 4.27sec 1231016 300.90sec
Ciaran Ciaran_treant wrath 113769 44514 206 28.29 362 728 102.3 101.8 12.9% 0.0% 0.0% 0.0% 3.13sec 44514 215.93sec
Kernoris Kernoris berserk 106952 0 0 0.40 0 0 2.0 2.0 28.9% 0.0% 0.0% 0.0% 183.38sec 0 300.90sec
Kernoris Kernoris cat_form 768 0 0 0.20 0 0 1.0 1.0 29.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Kernoris Kernoris cat_melee 0 1599112 5314 70.10 3323 6647 351.6 351.6 29.1% 0.0% 0.0% 0.0% 0.85sec 2457583 300.90sec
Kernoris Kernoris draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Kernoris Kernoris ferocious_bite 22568 1065835 3542 2.77 45720 91468 13.9 13.9 58.2% 0.0% 0.0% 0.0% 21.80sec 1638020 300.90sec
Kernoris Kernoris healing_touch 5185 0 0 5.78 0 0 29.0 29.0 32.2% 0.0% 0.0% 0.0% 10.59sec 966455 300.90sec
Kernoris Kernoris leader_of_the_pack 68285 0 0 7.87 0 0 39.5 39.5 0.0% 0.0% 0.0% 0.0% 7.69sec 328687 300.90sec
Kernoris Kernoris rake 1822 201799 671 4.64 6335 12661 23.3 23.3 29.2% 0.0% 0.0% 0.0% 13.04sec 1078292 300.90sec
Kernoris Kernoris rake ticks -1822 876493 2922 19.80 6457 12919 23.3 99.0 29.2% 0.0% 0.0% 0.0% 13.04sec 1078292 300.90sec
Kernoris Kernoris rip ticks -1079 1276314 4254 28.57 6529 13056 9.4 142.8 29.1% 0.0% 0.0% 0.0% 25.02sec 1276314 300.90sec
Kernoris Kernoris savage_roar 52610 0 0 1.53 0 0 7.7 7.7 0.0% 0.0% 0.0% 0.0% 37.55sec 0 300.90sec
Kernoris Kernoris shred 5221 1276998 4244 19.48 9550 19100 97.7 97.7 29.2% 0.0% 0.0% 0.0% 3.08sec 1962545 300.90sec
Kernoris Kernoris thrash_cat 106830 15488 51 0.49 4620 9238 2.4 2.4 29.1% 0.0% 0.0% 0.0% 62.77sec 70068 300.90sec
Kernoris Kernoris thrash_cat ticks -106830 54580 182 2.41 3304 6602 2.4 12.1 29.2% 0.0% 0.0% 0.0% 62.77sec 70068 300.90sec
Kernoris Kernoris tigers_fury 5217 0 0 2.04 0 0 10.2 10.2 29.1% 0.0% 0.0% 0.0% 30.55sec 0 300.90sec
Mekkasus Mekkasus a_murder_of_crows 131894 0 0 1.07 0 0 5.4 5.4 0.0% 0.0% 0.0% 0.0% 61.30sec 0 300.90sec
Mekkasus Mekkasus crow_peck 131900 603532 2006 15.67 5817 11860 0.0 78.6 22.7% 0.0% 0.0% 0.0% 0.00sec 927533 300.90sec
Mekkasus Mekkasus arcane_shot 3044 475319 1580 12.08 5937 12110 60.8 60.6 22.7% 0.0% 0.0% 0.0% 4.88sec 475319 300.90sec
Mekkasus Mekkasus auto_shot 0 528063 1755 26.00 3067 6257 130.4 130.4 22.7% 0.0% 0.0% 0.0% 2.32sec 811550 300.90sec
Mekkasus Mekkasus bestial_wrath 19574 0 0 1.05 0 0 5.3 5.3 0.0% 0.0% 0.0% 0.0% 62.70sec 0 300.90sec
Mekkasus Mekkasus cobra_shot 77767 365935 1216 17.23 3206 6541 86.7 86.4 22.7% 0.0% 0.0% 0.0% 3.33sec 365935 300.90sec
Mekkasus Mekkasus dire_beast 120679 0 0 2.05 0 0 10.3 10.3 0.0% 0.0% 0.0% 0.0% 30.70sec 0 300.90sec
Mekkasus Mekkasus_dire_beast_1 dire_beast_melee 0 367271 2569 40.65 2893 5786 96.8 96.8 22.7% 0.0% 0.0% 0.0% 3.09sec 564437 142.94sec
Mekkasus Mekkasus draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Mekkasus Mekkasus focus_fire 82692 0 0 1.44 0 0 7.2 7.2 0.0% 0.0% 0.0% 0.0% 38.87sec 0 300.90sec
Mekkasus Mekkasus glaive_toss 117050 0 0 0.00 0 0 19.0 0.0 0.0% 0.0% 0.0% 0.0% 16.06sec 0 300.90sec
Mekkasus Mekkasus glaive_1 0 130436 433 3.74 5261 10726 0.0 18.8 22.8% 0.0% 0.0% 0.0% 0.00sec 200460 300.90sec
Mekkasus Mekkasus glaive_2 0 130541 434 3.74 5270 10741 0.0 18.8 22.7% 0.0% 0.0% 0.0% 0.00sec 200620 300.90sec
Mekkasus Mekkasus kill_command 34026 0 0 8.53 0 0 42.8 42.8 0.0% 0.0% 0.0% 0.0% 7.06sec 0 300.90sec
Mekkasus Mekkasus_cat kill_command 83381 766661 2548 8.53 12639 25273 42.8 42.8 32.7% 0.0% 0.0% 0.0% 7.06sec 1178237 300.90sec
Mekkasus Mekkasus kill_shot 53351 579007 1924 3.80 23027 47000 19.1 19.0 22.7% 0.0% 0.0% 0.0% 5.75sec 889843 300.90sec
Mekkasus Mekkasus summon_pet 0 0 0 0.20 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Mekkasus Mekkasus_cat claw 16827 533176 1772 19.56 3579 7262 98.1 98.1 41.0% 0.0% 0.0% 0.0% 3.09sec 819407 300.90sec
Mekkasus Mekkasus_cat melee 0 862751 2867 46.07 2633 5267 231.0 231.0 32.7% 0.0% 0.0% 0.0% 1.30sec 1325912 300.90sec
Rapáx Rapáx a_murder_of_crows 131894 0 0 1.05 0 0 5.3 5.3 0.0% 0.0% 0.0% 0.0% 62.18sec 0 300.90sec
Rapáx Rapáx crow_peck 131900 461207 1533 15.43 4110 8253 0.0 77.4 33.5% 0.0% 0.0% 0.0% 0.00sec 708802 300.90sec
Rapáx Rapáx arcane_shot 3044 493805 1641 8.48 7913 15852 42.8 42.5 33.3% 0.0% 0.0% 0.0% 7.04sec 493805 300.90sec
Rapáx Rapáx auto_shot 0 578615 1923 21.14 3718 7450 106.0 106.0 33.3% 0.0% 0.0% 0.0% 2.85sec 889240 300.90sec
Rapáx Rapáx barrage ticks -120360 693115 2310 37.27 2426 4858 11.6 186.3 33.0% 0.0% 0.0% 0.0% 25.43sec 1015264 300.90sec
Rapáx Rapáx black_arrow ticks -3674 792004 2640 24.13 4472 8960 12.5 120.6 33.2% 0.0% 0.0% 0.0% 25.03sec 792004 300.90sec
Rapáx Rapáx cobra_shot 77767 542037 1801 15.65 4712 9434 78.7 78.5 33.1% 0.0% 0.0% 0.0% 3.75sec 542037 300.90sec
Rapáx Rapáx draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Rapáx Rapáx exotic_munitions 162534 0 0 0.20 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Rapáx Rapáx explosive_shot 53301 364983 1213 14.78 3355 6723 74.3 74.1 33.3% 0.0% 0.0% 0.0% 4.04sec 1449288 300.90sec
Rapáx Rapáx explosive_shot ticks -53301 1084305 3614 33.50 4411 8829 74.3 167.5 33.3% 0.0% 0.0% 0.0% 4.04sec 1449288 300.90sec
Rapáx Rapáx poisoned_ammo ticks -170661 245681 819 29.98 1231 2453 106.0 149.9 33.4% 0.0% 0.0% 0.0% 2.85sec 245681 300.90sec
Rapáx Rapáx serpent_sting ticks -118253 896495 2988 28.07 4352 8714 42.5 140.4 33.2% 0.0% 0.0% 0.0% 7.06sec 896495 300.90sec
Rapáx Rapáx summon_pet 0 0 0 0.20 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Rapáx Rapáx_cat claw 16827 221872 737 14.55 1949 3927 73.0 73.0 43.3% 0.0% 0.0% 0.0% 4.17sec 340982 300.90sec
Rapáx Rapáx_cat melee 0 538402 1789 39.18 1763 3533 196.5 196.5 43.2% 0.0% 0.0% 0.0% 1.53sec 827438 300.90sec
Rosalîîe Rosalîîe a_murder_of_crows 131894 0 0 1.06 0 0 5.3 5.3 0.0% 0.0% 0.0% 0.0% 61.88sec 0 300.90sec
Rosalîîe Rosalîîe crow_peck 131900 503542 1673 15.50 4428 8859 0.0 77.7 28.0% 0.0% 0.0% 0.0% 0.00sec 773864 300.90sec
Rosalîîe Rosalîîe arcane_shot 3044 492879 1638 6.26 10555 21106 31.7 31.4 27.9% 0.0% 0.0% 0.0% 9.60sec 492879 300.90sec
Rosalîîe Rosalîîe auto_shot 0 765110 2543 21.23 4836 9672 106.5 106.5 27.9% 0.0% 0.0% 0.0% 2.84sec 1175853 300.90sec
Rosalîîe Rosalîîe barrage ticks -120360 834139 2780 42.45 2488 4977 13.3 212.2 28.0% 0.0% 0.0% 0.0% 22.39sec 1196100 300.90sec
Rosalîîe Rosalîîe black_arrow ticks -3674 1115292 3718 24.24 6188 12374 12.6 121.2 28.0% 0.0% 0.0% 0.0% 24.87sec 1115292 300.90sec
Rosalîîe Rosalîîe cobra_shot 77767 762361 2534 16.20 6324 12645 81.4 81.2 28.0% 0.0% 0.0% 0.0% 3.62sec 762361 300.90sec
Rosalîîe Rosalîîe draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Rosalîîe Rosalîîe explosive_shot 53301 514478 1710 14.84 4643 9286 74.7 74.4 28.0% 0.0% 0.0% 0.0% 4.03sec 2040032 300.90sec
Rosalîîe Rosalîîe explosive_shot ticks -53301 1525554 5085 33.65 6107 12210 74.7 168.3 28.0% 0.0% 0.0% 0.0% 4.03sec 2040032 300.90sec
Rosalîîe Rosalîîe serpent_sting ticks -118253 891642 2972 25.94 4628 9257 31.4 129.7 28.0% 0.0% 0.0% 0.0% 9.65sec 891642 300.90sec
Procrank Procrank draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Procrank Procrank frostbolt 116 1328937 4417 19.81 9213 18561 99.6 99.3 14.9% 0.0% 0.0% 0.0% 2.99sec 1328937 300.90sec
Procrank Procrank icicle_fb 148022 536930 1784 36.00 2974 0 181.6 180.5 0.0% 0.0% 0.0% 0.0% 2.00sec 536930 300.90sec
Procrank Procrank frostfire_bolt 44614 1082581 3598 6.15 15524 31366 30.9 30.9 73.1% 0.0% 0.0% 0.0% 9.46sec 1082581 300.90sec
Procrank Procrank icicle_ffb 148022 398766 1325 11.83 6719 0 59.6 59.3 0.0% 0.0% 0.0% 0.0% 5.16sec 398766 300.90sec
Procrank Procrank frozen_orb 84714 0 0 1.08 0 0 5.4 5.4 0.0% 0.0% 0.0% 0.0% 61.00sec 0 300.90sec
Procrank Procrank frozen_orb_bolt 84721 258374 859 10.62 3127 6244 0.0 53.3 17.9% 0.0% 0.0% 0.0% 0.00sec 258374 300.90sec
Procrank Procrank ice_lance 30455 1380120 4587 9.71 12602 25361 48.9 48.7 74.0% 0.0% 0.0% 0.0% 6.13sec 1380120 300.90sec
Procrank Procrank ice_nova 157997 654610 2176 2.68 32103 64423 13.4 13.4 15.5% 0.0% 0.0% 0.0% 23.09sec 654610 300.90sec
Procrank Procrank icy_veins 12472 0 0 0.41 0 0 2.1 2.1 14.0% 0.0% 0.0% 0.0% 181.57sec 0 300.90sec
Procrank Procrank mirror_image 55342 0 0 0.60 0 0 3.0 3.0 15.1% 0.0% 0.0% 0.0% 120.63sec 0 300.90sec
Procrank Procrank_mirror_image frostbolt 59638 1055594 9442 105.16 3455 7001 196.9 195.9 19.1% 0.0% 0.0% 0.0% 4.16sec 1055594 111.80sec
Procrank Procrank shattered_bleed 159238 38553 128 3.34 1584 3169 16.7 16.7 15.2% 0.0% 0.0% 0.0% 18.34sec 133430 300.90sec
Procrank Procrank shattered_bleed ticks -159238 94877 316 18.98 783 0 16.7 94.9 0.0% 0.0% 0.0% 0.0% 18.34sec 133430 300.90sec
Procrank Procrank water_elemental 31687 0 0 0.20 0 0 1.0 1.0 13.1% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Procrank Procrank_water_elemental water_jet ticks -135029 133167 444 7.94 2274 4588 10.0 39.7 16.1% 0.0% 0.0% 0.0% 30.33sec 133167 300.90sec
Procrank Procrank_water_elemental waterbolt 31707 629158 2091 22.01 3870 7795 111.3 110.4 15.2% 0.0% 0.0% 0.0% 2.69sec 629158 300.90sec
Zentimeter Zentimeter draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Zentimeter Zentimeter frostbolt 116 1279407 4252 20.56 8847 17842 103.4 103.1 12.8% 0.0% 0.0% 0.0% 2.88sec 1279407 300.90sec
Zentimeter Zentimeter icicle_fb 148022 585750 1947 36.04 3241 0 181.8 180.7 0.0% 0.0% 0.0% 0.0% 1.97sec 585750 300.90sec
Zentimeter Zentimeter frostfire_bolt 44614 994381 3305 6.05 14935 30168 30.4 30.4 69.8% 0.0% 0.0% 0.0% 9.62sec 994381 300.90sec
Zentimeter Zentimeter icicle_ffb 148022 418260 1390 11.38 7331 0 57.3 57.1 0.0% 0.0% 0.0% 0.0% 5.35sec 418260 300.90sec
Zentimeter Zentimeter frozen_orb 84714 0 0 1.08 0 0 5.4 5.4 0.0% 0.0% 0.0% 0.0% 61.07sec 0 300.90sec
Zentimeter Zentimeter frozen_orb_bolt 84721 241290 802 10.61 3009 6004 0.0 53.2 15.7% 0.0% 0.0% 0.0% 0.00sec 241290 300.90sec
Zentimeter Zentimeter ice_lance 30455 1297987 4314 9.81 12114 24371 49.3 49.2 70.6% 0.0% 0.0% 0.0% 6.07sec 1297987 300.90sec
Zentimeter Zentimeter ice_nova 157997 613534 2039 2.68 30862 62044 13.4 13.4 13.5% 0.0% 0.0% 0.0% 23.09sec 613534 300.90sec
Zentimeter Zentimeter icy_veins 12472 0 0 0.41 0 0 2.1 2.1 11.4% 0.0% 0.0% 0.0% 181.12sec 0 300.90sec
Zentimeter Zentimeter mirror_image 55342 0 0 0.60 0 0 3.0 3.0 13.2% 0.0% 0.0% 0.0% 120.73sec 0 300.90sec
Zentimeter Zentimeter_mirror_image frostbolt 59638 1011454 9054 107.90 3326 6757 201.9 200.9 16.9% 0.0% 0.0% 0.0% 4.06sec 1011454 111.72sec
Zentimeter Zentimeter water_elemental 31687 0 0 0.20 0 0 1.0 1.0 11.1% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Zentimeter Zentimeter_water_elemental water_jet ticks -135029 128391 428 7.94 2268 4584 10.0 39.7 13.9% 0.0% 0.0% 0.0% 30.37sec 128391 300.90sec
Zentimeter Zentimeter_water_elemental waterbolt 31707 625497 2079 22.65 3858 7779 114.5 113.6 13.0% 0.0% 0.0% 0.0% 2.61sec 625497 300.90sec
Zambo Zambo avenging_wrath 31884 0 0 0.59 0 0 3.0 3.0 16.6% 0.0% 0.0% 0.0% 121.50sec 0 300.90sec
Zambo Zambo censure ticks -31803 221962 740 19.87 1831 3679 297.0 99.4 13.1% 0.0% 0.0% 0.0% 1.01sec 221962 300.90sec
Zambo Zambo crusader_strike 35395 519208 1726 12.39 6851 13770 62.1 62.1 13.0% 0.0% 0.0% 0.0% 4.82sec 797941 300.90sec
Zambo Zambo divine_storm 53385 514089 1709 4.05 20778 41656 20.3 20.3 12.9% 0.0% 0.0% 0.0% 14.00sec 514089 300.90sec
Zambo Zambo draenic_strength_potion 156428 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Zambo Zambo execution_sentence ticks -114157 377994 1260 10.69 5721 11862 5.5 53.4 13.7% 0.0% 0.0% 0.0% 60.78sec 377994 300.90sec
Zambo Zambo exorcism 879 106608 354 1.85 9451 18897 9.3 9.3 13.0% 0.0% 0.0% 0.0% 18.14sec 106608 300.90sec
Zambo Zambo final_verdict 157048 1741316 5787 13.33 21364 42963 66.8 66.8 13.0% 0.0% 0.0% 0.0% 4.47sec 1741316 300.90sec
Zambo Zambo glyph_of_divine_storm 63220 0 0 4.05 0 0 20.3 20.3 16.2% 0.0% 0.0% 0.0% 14.00sec 277273 300.90sec
Zambo Zambo hammer_of_wrath 24275 601056 1998 6.00 16323 33029 30.1 30.1 13.3% 0.0% 0.0% 0.0% 10.21sec 601056 300.90sec
Zambo Zambo hand_of_light 96172 2039334 6777 45.06 9026 0 226.0 226.0 0.0% 0.0% 0.0% 0.0% 1.68sec 2039334 300.90sec
Zambo Zambo judgment 20271 457400 1520 7.85 9511 19189 39.4 39.4 13.1% 0.0% 0.0% 0.0% 7.58sec 457400 300.90sec
Zambo Zambo melee 0 746001 2479 19.66 6193 12462 98.6 98.6 13.2% 0.0% 0.0% 0.0% 3.04sec 1146485 300.90sec
Zambo Zambo seal_of_truth_proc 31801 417215 1387 59.23 1148 2311 297.0 297.0 13.4% 0.0% 0.0% 0.0% 1.01sec 417215 300.90sec
Zambo Zambo shattered_bleed 159238 35354 117 3.49 1651 3307 17.5 17.5 13.5% 0.0% 0.0% 0.0% 17.55sec 118305 300.90sec
Zambo Zambo shattered_bleed ticks -159238 82951 277 19.54 787 0 17.5 97.7 0.0% 0.0% 0.0% 0.0% 17.55sec 118305 300.90sec
Ðepeche Ðepeche avenging_wrath 31884 0 0 0.60 0 0 3.0 3.0 19.5% 0.0% 0.0% 0.0% 121.10sec 0 300.90sec
Ðepeche Ðepeche censure ticks -31803 216912 723 19.87 1761 3673 303.6 99.4 14.9% 0.0% 0.0% 0.0% 0.99sec 216912 300.90sec
Ðepeche Ðepeche crusader_strike 35395 508278 1689 12.62 6526 13503 63.3 63.3 14.3% 0.0% 0.0% 0.0% 4.74sec 781142 300.90sec
Ðepeche Ðepeche divine_storm 53385 394334 1311 3.20 19820 41216 16.1 16.1 14.9% 0.0% 0.0% 0.0% 17.57sec 394334 300.90sec
Ðepeche Ðepeche draenic_strength_potion 156428 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Ðepeche Ðepeche execution_sentence ticks -114157 370805 1236 10.73 5369 11934 5.5 53.7 16.9% 0.0% 0.0% 0.0% 60.46sec 370805 300.90sec
Ðepeche Ðepeche exorcism 879 102709 341 1.93 8844 17688 9.7 9.7 12.6% 0.0% 0.0% 0.0% 16.31sec 102709 300.90sec
Ðepeche Ðepeche final_verdict 157048 1343791 4466 10.56 20473 42634 52.9 52.9 15.0% 0.0% 0.0% 0.0% 5.65sec 1343791 300.90sec
Ðepeche Ðepeche hammer_of_wrath 24275 1108930 3685 10.56 16469 34252 53.0 53.0 17.8% 0.0% 0.0% 0.0% 5.72sec 1108930 300.90sec
Ðepeche Ðepeche hand_of_light 96172 1791491 5954 45.15 7912 0 226.4 226.4 0.0% 0.0% 0.0% 0.0% 1.62sec 1791491 300.90sec
Ðepeche Ðepeche judgment 20271 347576 1155 6.90 8348 16704 34.6 34.6 12.7% 0.0% 0.0% 0.0% 7.72sec 347576 300.90sec
Ðepeche Ðepeche melee 0 734245 2440 19.89 5937 12361 99.7 99.7 15.0% 0.0% 0.0% 0.0% 3.01sec 1128418 300.90sec
Ðepeche Ðepeche seal_of_truth_proc 31801 415887 1382 60.54 1102 2299 303.6 303.6 15.2% 0.0% 0.0% 0.0% 0.99sec 415887 300.90sec
Ðepeche Ðepeche shattered_bleed 159238 35974 120 3.52 1653 3377 17.6 17.6 14.9% 0.0% 0.0% 0.0% 17.35sec 117771 300.90sec
Ðepeche Ðepeche shattered_bleed ticks -159238 81797 273 19.72 777 0 17.6 98.6 0.0% 0.0% 0.0% 0.0% 17.35sec 117771 300.90sec
Swæty Swæty devouring_plague 2944 607140 2018 4.33 22033 44070 21.7 21.7 18.7% 0.0% 0.0% 0.0% 13.28sec 607140 300.90sec
Swæty Swæty devouring_plague_tick ticks -2944 596914 1990 26.53 3747 0 26.7 132.7 0.0% 0.0% 0.0% 0.0% 10.72sec 0 300.90sec
Swæty Swæty draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Swæty Swæty halo 120644 0 0 1.33 0 0 6.7 6.7 18.7% 0.0% 0.0% 0.0% 48.26sec 0 300.90sec
Swæty Swæty halo_damage 120696 207755 690 1.33 24466 48958 6.7 6.7 18.9% 0.0% 0.0% 0.0% 48.26sec 207755 300.90sec
Swæty Swæty insanity ticks -129197 919451 3065 18.98 7636 15272 35.3 94.9 18.8% 0.0% 0.0% 0.0% 7.88sec 919451 300.90sec
Swæty Swæty mind_blast 8092 1684954 5600 11.33 23379 46754 56.8 56.8 18.8% 0.0% 0.0% 0.0% 5.34sec 1684954 300.90sec
Swæty Swæty mind_spike 73510 1278758 4250 13.37 15042 30077 67.0 67.0 18.8% 0.0% 0.0% 0.0% 4.39sec 1278758 300.90sec
Swæty Swæty shadow_word_death 32379 412222 1370 2.27 28539 57100 11.4 11.4 18.8% 0.0% 0.0% 0.0% 5.38sec 412230 300.90sec
Swæty Swæty shadow_word_pain 589 33611 112 1.52 3483 6964 7.6 7.6 18.7% 0.0% 0.0% 0.0% 30.76sec 243809 300.90sec
Swæty Swæty shadow_word_pain ticks -589 210198 701 10.17 3250 6501 7.6 50.8 18.8% 0.0% 0.0% 0.0% 30.76sec 243809 300.90sec
Swæty Swæty shadowy_apparitions 78203 38938 129 1.91 3206 6412 9.6 9.6 18.8% 0.0% 0.0% 0.0% 22.15sec 38938 300.90sec
Swæty Swæty shadowfiend 34433 0 0 0.40 0 0 2.0 2.0 18.7% 0.0% 0.0% 0.0% 187.54sec 0 300.90sec
Swæty Swæty shadowform 15473 0 0 0.20 0 0 1.0 1.0 19.3% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Swæty Swæty shattered_bleed 159238 34468 115 3.39 1596 3192 17.0 17.0 18.8% 0.0% 0.0% 0.0% 17.96sec 115364 300.90sec
Swæty Swæty shattered_bleed ticks -159238 80896 270 19.19 789 0 17.0 95.9 0.0% 0.0% 0.0% 0.0% 17.96sec 115364 300.90sec
Swæty Swæty vampiric_touch ticks -34914 214552 715 8.62 3906 7809 7.5 43.1 18.8% 0.0% 0.0% 0.0% 31.43sec 214552 300.90sec
Swæty Swæty_shadowfiend melee 0 138444 5752 49.93 5448 10899 20.0 20.0 18.8% 0.0% 0.0% 0.0% 10.56sec 138444 24.07sec
Swæty Swæty_shadowfiend shadowcrawl 63619 0 0 15.00 0 0 6.0 6.0 18.6% 0.0% 0.0% 0.0% 40.44sec 0 24.07sec
Ralana Ralana adrenaline_rush 13750 0 0 0.78 0 0 3.9 3.9 0.0% 0.0% 0.0% 0.0% 85.89sec 0 300.90sec
Ralana Ralana ambush 8676 131524 437 1.41 14548 29086 7.1 7.1 22.1% 0.0% 0.0% 0.0% 48.84sec 202131 300.90sec
Ralana Ralana auto_attack_mh 0 1356821 4509 43.72 4853 9706 219.3 219.3 21.8% 0.0% 0.0% 0.0% 1.37sec 2085219 300.90sec
Ralana Ralana auto_attack_oh 1 666037 2213 42.98 2423 4845 215.5 215.5 21.9% 0.0% 0.0% 0.0% 1.39sec 1023594 300.90sec
Ralana Ralana draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Ralana Ralana eviscerate 2098 979523 3255 7.25 21126 42229 36.4 36.4 21.9% 0.0% 0.0% 0.0% 7.90sec 1505372 300.90sec
Ralana Ralana instant_poison 157607 606929 2017 42.05 2257 4514 210.9 210.9 21.8% 0.0% 0.0% 0.0% 1.45sec 606929 300.90sec
Ralana Ralana killing_spree 51690 0 0 1.15 0 0 5.7 5.7 0.0% 0.0% 0.0% 0.0% 56.89sec 0 300.90sec
Ralana Ralana killing_spree_mh ticks -57841 243760 813 0.00 4659 9322 40.1 0.0 21.9% 0.0% 0.0% 0.0% 6.99sec 365852 300.90sec
Ralana Ralana killing_spree_oh ticks -57842 121925 406 0.00 2330 4659 40.1 0.0 21.9% 0.0% 0.0% 0.0% 6.99sec 183000 300.90sec
Ralana Ralana main_gauche 86392 881300 2929 42.19 3266 6533 211.6 211.6 21.9% 0.0% 0.0% 0.0% 1.49sec 1354419 300.90sec
Ralana Ralana preparation 14185 0 0 0.24 0 0 1.2 1.2 0.0% 0.0% 0.0% 0.0% 313.92sec 0 300.90sec
Ralana Ralana revealing_strike 84617 89004 296 2.53 5500 10998 12.7 12.7 21.8% 0.0% 0.0% 0.0% 24.24sec 1135095 300.90sec
Ralana Ralana sinister_strike 1752 1213729 4034 26.33 7208 14420 132.0 132.0 21.8% 0.0% 0.0% 0.0% 2.24sec 1865310 300.90sec
Ralana Ralana slice_and_dice 5171 0 0 1.95 0 0 9.8 9.8 0.0% 0.0% 0.0% 0.0% 32.15sec 0 300.90sec
Ralana Ralana vanish 1856 0 0 1.21 0 0 6.1 6.1 0.0% 0.0% 0.0% 0.0% 48.83sec 0 300.90sec
Mîrai Mîrai ambush 8676 934723 3106 6.38 19776 42484 32.0 32.0 26.5% 0.0% 0.0% 0.0% 9.20sec 1011175 300.90sec
Mîrai Mîrai auto_attack_mh 0 1537008 5108 64.12 3909 8483 321.6 321.6 24.4% 19.0% 0.0% 0.0% 0.94sec 1818109 300.90sec
Mîrai Mîrai auto_attack_oh 1 738479 2454 63.56 1893 4119 318.8 318.8 24.4% 19.0% 0.0% 0.0% 0.94sec 873952 300.90sec
Mîrai Mîrai backstab 53 877320 2916 16.49 7464 15967 82.7 82.7 23.4% 0.0% 0.0% 0.0% 3.47sec 1087856 300.90sec
Mîrai Mîrai deadly_poison_dot ticks -2818 272626 909 19.89 1924 4071 200.3 99.5 24.2% 0.0% 0.0% 0.0% 1.50sec 272626 300.90sec
Mîrai Mîrai deadly_poison_instant 113780 285010 947 39.75 1001 2126 199.3 199.3 24.4% 0.0% 0.0% 0.0% 1.50sec 285010 300.90sec
Mîrai Mîrai draenic_agility_potion 156423 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Mîrai Mîrai eviscerate 2098 1474969 4902 6.83 29832 64946 34.2 34.2 24.4% 0.0% 0.0% 0.0% 8.65sec 1677148 300.90sec
Mîrai Mîrai garrote ticks -703 12572 42 1.80 924 1893 1.0 9.0 33.2% 0.0% 0.0% 0.0% 0.00sec 12572 300.90sec
Mîrai Mîrai premeditation 14183 0 0 1.74 0 0 8.7 8.7 0.0% 0.0% 0.0% 0.0% 37.44sec 0 300.90sec
Mîrai Mîrai preparation 14185 0 0 0.23 0 0 1.2 1.2 0.0% 0.0% 0.0% 0.0% 312.42sec 0 300.90sec
Mîrai Mîrai rupture ticks -1943 1353741 4512 38.45 4940 10467 16.7 192.3 24.2% 0.0% 0.0% 0.0% 18.36sec 1353741 300.90sec
Mîrai Mîrai shadow_dance 51713 0 0 1.05 0 0 5.3 5.3 0.0% 0.0% 0.0% 0.0% 61.97sec 0 300.90sec
Mîrai Mîrai shadow_reflection 152151 0 0 0.57 0 0 2.9 2.9 0.0% 0.0% 0.0% 0.0% 124.46sec 0 300.90sec
Mîrai Mîrai shattered_bleed 159238 39285 131 3.38 1647 3364 17.0 17.0 24.3% 0.0% 0.0% 0.0% 18.04sec 122914 300.90sec
Mîrai Mîrai shattered_bleed ticks -159238 83629 279 18.87 789 0 17.0 94.4 0.0% 0.0% 0.0% 0.0% 18.04sec 122914 300.90sec
Mîrai Mîrai slice_and_dice 5171 0 0 1.76 0 0 8.8 8.8 0.0% 0.0% 0.0% 0.0% 36.24sec 0 300.90sec
Mîrai Mîrai vanish 1856 0 0 0.84 0 0 4.2 4.2 0.0% 0.0% 0.0% 0.0% 72.61sec 0 300.90sec
Mîrai Mîrai_shadow_reflection ambush 8676 189913 4234 14.15 12062 24435 10.6 10.6 31.8% 0.0% 0.0% 0.0% 23.99sec 291866 44.85sec
Mîrai Mîrai_shadow_reflection backstab 53 760 17 0.12 5780 11740 0.1 0.1 31.2% 0.0% 0.0% 0.0% 45.74sec 1168 44.85sec
Mîrai Mîrai_shadow_reflection eviscerate 2098 115559 2577 3.94 26523 53847 2.9 2.9 31.0% 0.0% 0.0% 0.0% 95.18sec 177596 44.85sec
Mîrai Mîrai_shadow_reflection rupture ticks -1943 135225 451 4.62 4085 8599 2.0 23.1 25.2% 0.0% 0.0% 0.0% 146.41sec 135225 44.85sec
Shaerlyn Shaerlyn ascendance 165339 0 0 0.40 0 0 2.0 2.0 15.4% 0.0% 0.0% 0.0% 181.24sec 0 300.90sec
Shaerlyn Shaerlyn draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Shaerlyn Shaerlyn earth_shock 8042 270331 898 3.28 9730 24306 16.4 16.4 15.5% 0.0% 0.0% 0.0% 17.96sec 270331 300.90sec
Shaerlyn Shaerlyn fulmination 88766 734739 2442 3.28 26414 66092 16.4 16.4 15.5% 0.0% 0.0% 0.0% 17.96sec 734739 300.90sec
Shaerlyn Shaerlyn elemental_mastery 16166 0 0 0.60 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 121.19sec 0 300.90sec
Shaerlyn Shaerlyn fire_elemental_totem 2894 0 0 0.30 0 0 1.5 1.5 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Shaerlyn Shaerlyn flame_shock 8050 73671 245 2.14 4065 10154 10.7 10.7 15.5% 0.0% 0.0% 0.0% 29.20sec 511823 300.90sec
Shaerlyn Shaerlyn flame_shock ticks -8050 438152 1461 24.96 2073 5181 10.7 124.8 15.4% 0.0% 0.0% 0.0% 29.20sec 511823 300.90sec
Shaerlyn Shaerlyn lava_burst 51505 3023461 10048 12.06 0 34501 60.6 60.5 100.0% 0.0% 0.0% 0.0% 4.91sec 3023461 300.90sec
Shaerlyn Shaerlyn lightning_bolt 403 1981343 6585 19.03 12307 30768 95.7 95.4 15.4% 0.0% 0.0% 0.0% 2.92sec 1981343 300.90sec
Shaerlyn Shaerlyn lightning_shield 324 0 0 0.20 0 0 1.0 1.0 15.5% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Shaerlyn Shaerlyn molten_earth 170379 1218138 4048 24.94 5760 14399 125.5 125.1 15.4% 0.0% 0.0% 0.0% 2.38sec 1218138 300.90sec
Shaerlyn Shaerlyn searing_totem 3599 0 0 0.77 0 0 3.9 3.9 0.0% 0.0% 0.0% 0.0% 66.15sec 0 300.90sec
Shaerlyn Shaerlyn unleash_flame 165462 0 0 3.65 0 0 18.3 18.3 0.0% 0.0% 0.0% 0.0% 16.83sec 0 300.90sec
Shaerlyn Shaerlyn_greater_fire_elemental fire_blast 57984 15504 202 9.91 775 1938 12.7 12.7 15.4% 0.0% 0.0% 0.0% 15.53sec 15504 76.93sec
Shaerlyn Shaerlyn_greater_fire_elemental melee 0 200811 2610 57.24 1738 4344 73.4 73.4 15.4% 0.0% 0.0% 0.0% 2.55sec 200811 76.93sec
Shaerlyn Shaerlyn_searing_totem searing_bolt 3606 249074 1206 35.40 1301 3252 122.2 121.9 15.4% 0.0% 0.0% 0.0% 1.83sec 249074 206.61sec
Candylicious Candylicious chaos_bolt 116858 1720093 5717 4.90 0 62580 24.8 24.6 100.0% 0.0% 0.0% 0.0% 12.03sec 1720093 300.90sec
Candylicious Candylicious conflagrate 17962 617264 2051 5.26 16172 33104 26.4 26.4 28.0% 0.0% 0.0% 0.0% 11.57sec 617264 300.90sec
Candylicious Candylicious dark_soul 113858 0 0 0.60 0 0 3.0 3.0 21.9% 0.0% 0.0% 0.0% 120.79sec 0 300.90sec
Candylicious Candylicious draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Candylicious Candylicious immolate 348 229757 764 4.11 7821 15996 20.6 20.6 26.3% 0.0% 0.0% 0.0% 14.90sec 907799 300.90sec
Candylicious Candylicious immolate ticks -348 678042 2260 24.48 3891 7915 20.6 122.4 26.3% 0.0% 0.0% 0.0% 14.90sec 907799 300.90sec
Candylicious Candylicious incinerate 29722 2192329 7286 27.51 11303 22988 138.9 138.0 24.8% 0.0% 0.0% 0.0% 2.16sec 2192329 300.90sec
Candylicious Candylicious summon_terrorguard 112927 0 0 0.40 0 0 1.0 2.0 18.1% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Candylicious Candylicious_terrorguard doom_bolt 85692 2070166 6880 21.16 13671 27783 106.8 106.1 26.7% 0.0% 0.0% 0.0% 2.81sec 2070166 300.90sec
Dârkride Dârkride auto_attack_mh 0 739787 2459 26.58 4466 9034 133.3 133.3 19.0% 0.0% 0.0% 0.0% 2.27sec 1136936 300.90sec
Dârkride Dârkride berserker_rage 18499 0 0 1.82 0 0 9.1 9.1 0.0% 0.0% 0.0% 0.0% 34.46sec 0 300.90sec
Dârkride Dârkride blood_craze 159362 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 16.23sec 137038 300.90sec
Dârkride Dârkride bloodbath ticks -113344 379046 1263 18.43 4113 0 5.5 92.2 0.0% 0.0% 0.0% 0.0% 60.04sec 379046 300.90sec
Dârkride Dârkride charge 100 0 0 0.20 0 0 1.0 1.0 16.5% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Dârkride Dârkride deep_wounds ticks -115767 590227 1967 19.73 4828 9736 120.8 98.7 18.8% 0.0% 0.0% 0.0% 2.47sec 590227 300.90sec
Dârkride Dârkride devastate 20243 1311719 4359 24.09 8731 17701 120.8 120.8 19.0% 0.0% 0.0% 0.0% 2.47sec 2015904 300.90sec
Dârkride Dârkride draenic_armor_potion 156430 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.90sec
Dârkride Dârkride dragon_roar 118000 160711 534 1.07 0 28753 5.4 5.4 100.0% 0.0% 0.0% 0.0% 61.13sec 160711 300.90sec
Dârkride Dârkride execute 5308 204744 680 1.30 25397 50858 6.5 6.5 18.5% 0.0% 0.0% 0.0% 7.95sec 314659 300.90sec
Dârkride Dârkride heroic_leap 6544 23491 78 1.37 2730 5622 6.9 6.9 19.4% 0.0% 0.0% 0.0% 46.03sec 36102 300.90sec
Dârkride Dârkride heroic_strike 78 1217516 4046 37.32 4978 10190 187.2 187.2 24.5% 0.0% 0.0% 0.0% 1.61sec 1871130 300.90sec
Dârkride Dârkride revenge 6572 561372 1866 6.02 14998 30283 30.2 30.2 18.9% 0.0% 0.0% 0.0% 10.09sec 862740 300.90sec
Dârkride Dârkride shattered_bleed 159238 43582 145 3.38 2076 4160 17.0 17.0 18.9% 0.0% 0.0% 0.0% 18.12sec 123193 300.90sec
Dârkride Dârkride shattered_bleed ticks -159238 79611 265 19.22 796 0 17.0 96.1 0.0% 0.0% 0.0% 0.0% 18.12sec 123193 300.90sec
Dârkride Dârkride shield_charge 156321 0 0 4.24 0 0 21.3 21.3 0.0% 0.0% 0.0% 0.0% 14.53sec 0 300.90sec
Dârkride Dârkride shield_slam 23922 1367110 4543 13.33 16425 33388 66.9 66.9 19.1% 0.0% 0.0% 0.0% 4.52sec 2101033 300.90sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%

Charts

DPS Taken Timeline Chart
http://5.chart.apis.google.com/chart?cht=lc&chf=bg,s,333333&chtt=Fluffy_Pillow+DPS+Timeline&chts=dddddd,18&chs=550x200&chg=20,20&chxs=0,FFFFFF|1,FFFFFF&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=372|1:|0|&chxp=1,1,-1,100

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.26% 10.26% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.26%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.33% 10.33% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.33%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.51% 10.51% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.51%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.14% 11.14% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.14%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.57% 10.57% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.57%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.54% 10.54% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.68% 11.68% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.68%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.41% 11.41% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.41%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.10% 8.10% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.46% 5.46% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%
censure 1.0 302.6 0.0sec 1.0sec 99.56% 100.00% 298.6(298.6)

Buff details

  • buff initial source:Ðepeche
  • cooldown name:buff_censure
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • censure_1:0.34%
  • censure_2:0.11%
  • censure_3:0.23%
  • censure_4:0.34%
  • censure_5:98.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31803
  • name:Censure
  • tooltip:Holy damage every $t1 sec.
  • description:Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
censure 1.0 296.0 0.0sec 1.0sec 99.55% 100.00% 292.0(292.0)

Buff details

  • buff initial source:Zambo
  • cooldown name:buff_censure
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • censure_1:0.34%
  • censure_2:0.11%
  • censure_3:0.24%
  • censure_4:0.34%
  • censure_5:98.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31803
  • name:Censure
  • tooltip:Holy damage every $t1 sec.
  • description:Deals $m1 additional Holy damage over {$31803d=15 seconds}. Stacks up to {$31803u=5} times.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
find_weakness 9.5 23.5 33.1sec 9.2sec 48.62% 48.62% 23.5(23.5)

Buff details

  • buff initial source:Mîrai
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • find_weakness_1:48.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:91021
  • name:Find Weakness
  • tooltip:$w1% of armor is ignored by the attacking Rogue.
  • description:Your Ambush, Garrote, and Cheap Shot abilities reveal a flaw in your target's defenses, causing all your attacks to bypass a portion of that enemy's armor for {$91021d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
water_jet 10.0 0.0 30.3sec 30.3sec 11.58% 17.31% 0.0(0.0)

Buff details

  • buff initial source:Procrank_water_elemental
  • cooldown name:buff_water_jet
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • water_jet_1:11.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135029
  • name:Water Jet
  • tooltip:Taking $s1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
  • max_stacks:0
  • duration:4.00
  • cooldown:25.00
  • default_chance:0.00%
water_jet 10.0 0.0 30.4sec 30.4sec 11.31% 16.67% 0.0(0.0)

Buff details

  • buff initial source:Zentimeter_water_elemental
  • cooldown name:buff_water_jet
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • water_jet_1:11.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135029
  • name:Water Jet
  • tooltip:Taking $s1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
  • max_stacks:0
  • duration:4.00
  • cooldown:25.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bleeding_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 350227.29
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 35714
death count pct 142.83
avg death time 300.66
min death time 227.96
max death time 372.50
dmg taken 105393081.21

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 25000
Mean 300.90
Minimum 227.96
Maximum 372.50
Spread ( max - min ) 144.55
Range [ ( max - min ) / 2 * 100% ] 24.02%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 25000
Mean 350981.01
Minimum 334797.83
Maximum 369788.86
Spread ( max - min ) 34991.03
Range [ ( max - min ) / 2 * 100% ] 4.98%
Standard Deviation 6062.8418
5th Percentile 341115.65
95th Percentile 359833.72
( 95th Percentile - 5th Percentile ) 18718.07
Mean Distribution
Standard Deviation 38.3448
95.00% Confidence Intervall ( 350905.86 - 351056.16 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1146
0.1 Scale Factor Error with Delta=300 313787
0.05 Scale Factor Error with Delta=300 1255151
0.01 Scale Factor Error with Delta=300 31378786
Distribution Chart
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 6263
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 126205652 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Multistrike 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1938 1938 1938
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=103
race=humanoid
role=tank
position=front
spec=unknown


# Gear Summary

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Max Spike Damage

Maximum amount of net damage taken in any 6.00-second period, expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.